BEX1 (NM_018476) Human Recombinant Protein
CAT#: TP320965
Recombinant protein of human brain expressed, X-linked 1 (BEX1), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220965 protein sequence
Red=Cloning site Green=Tags(s) MESKEKRAVNSLSMENANQENEEKEQVANKGEPLALPLDAGEYCVPRGNRRRFRVRQPILQYRWDMMHRL GEPQARMREENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDHHDEFCLMP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060946 |
Locus ID | 55859 |
UniProt ID | Q9HBH7 |
Cytogenetics | Xq22 |
Refseq Size | 862 |
Refseq ORF | 375 |
Synonyms | BEX2; HBEX2; HGR74-h |
Summary | Signaling adapter molecule involved in p75NTR/NGFR signaling. Plays a role in cell cycle progression and neuronal differentiation. Inhibits neuronal differentiation in response to nerve growth factor (NGF). May act as a link between the cell cycle and neurotrophic factor signaling, possibly by functioning as an upstream modulator of receptor signaling, coordinating biological responses to external signals with internal cellular states (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413052 | BEX1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY413052 | Transient overexpression lysate of brain expressed, X-linked 1 (BEX1) |
USD 436.00 |
|
PH320965 | BEX1 MS Standard C13 and N15-labeled recombinant protein (NP_060946) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review