NRP2 (NM_201266) Human Recombinant Protein
CAT#: TP320920
Recombinant protein of human neuropilin 2 (NRP2), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220920 representing NM_201266
Red=Cloning site Green=Tags(s) MTFYSPAVMNYSVPGSTSNLDGGPVRLSTSPNVLWPTSGHLSPLATHCQSSLLYAEPQKSPWCEARSLEH TLPVNRETLKRKLSGSSCASPVTSPNAKRDAHFCPVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYIC PATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRIVRRQRSSSEQVHCLSKAKRNGGHAPRV KELLLSTLSPEQLVLTLLEAEPPNVLVSRPSMPFTEASMMMSLTKLADKELVHMIGWAKKIPGFVELSLL DQVRLLESCWMEVLMVGLMWRSIDHPGKLIFAPDLVLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHK EYLCVKAMILLNSSMYPLASANQEAESSRKLTHLLNAVTDALVWVIAKSGISSQQQSVRLANLLMLLSHV RHISNKGMEHLLSMKCKNVVPVYDLLLEMLNAHTLRGYKSSISGSECSSTEDSKNKESSQNLQSQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 102.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_957718 |
Locus ID | 8828 |
UniProt ID | O60462, Q7Z3T9 |
Cytogenetics | 2q33.3 |
Refseq Size | 6671 |
Refseq ORF | 2793 |
Synonyms | NP2; NPN2; PRO2714; VEGF165R2 |
Summary | This gene encodes a member of the neuropilin family of receptor proteins. The encoded transmembrane protein binds to SEMA3C protein {sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3C} and SEMA3F protein {sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3F}, and interacts with vascular endothelial growth factor (VEGF). This protein may play a role in cardiovascular development, axon guidance, and tumorigenesis. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401275 | NRP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC403706 | NRP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC404506 | NRP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC430844 | NRP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401275 | Transient overexpression lysate of neuropilin 2 (NRP2), transcript variant 2 |
USD 665.00 |
|
LY403706 | Transient overexpression lysate of neuropilin 2 (NRP2), transcript variant 1 |
USD 665.00 |
|
LY404506 | Transient overexpression lysate of neuropilin 2 (NRP2), transcript variant 5 |
USD 436.00 |
|
LY430844 | Transient overexpression lysate of neuropilin 2 (NRP2), transcript variant 6 |
USD 436.00 |
|
PH310928 | NRP2 MS Standard C13 and N15-labeled recombinant protein (NP_957719) |
USD 3,255.00 |
|
PH320920 | NRP2 MS Standard C13 and N15-labeled recombinant protein (NP_957718) |
USD 3,255.00 |
|
TP310928 | Recombinant protein of human neuropilin 2 (NRP2), transcript variant 5, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review