NRP2 (NM_201266) Human Tagged ORF Clone

CAT#: RC220920

Reviews ()
Write a review

NRP2 (Myc-DDK-tagged)-Human neuropilin 2 (NRP2), transcript variant 1



Reconstitution Protocol

USD 852.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "NRP2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NRP2
Synonyms NP2; NPN2; PRO2714; VEGF165R2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC220920 representing NM_201266
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATATGTTTCCTCTCACCTGGGTTTTCTTAGCCCTCTACTTTTCAAGACACCAAGTGAGAGGCCAAC
CAGACCCACCGTGCGGAGGTCGTTTGAATTCCAAAGATGCTGGCTATATCACCTCTCCCGGTTACCCCCA
GGACTACCCCTCCCACCAGAACTGCGAGTGGATTGTTTACGCCCCCGAACCCAACCAGAAGATTGTCCTC
AACTTCAACCCTCACTTTGAAATCGAGAAGCACGACTGCAAGTATGACTTTATCGAGATTCGGGATGGGG
ACAGTGAATCCGCAGACCTCCTGGGCAAACACTGTGGGAACATCGCCCCGCCCACCATCATCTCCTCGGG
CTCCATGCTCTACATCAAGTTCACCTCCGACTACGCCCGGCAGGGGGCAGGCTTCTCTCTGCGCTACGAG
ATCTTCAAGACAGGCTCTGAAGATTGCTCAAAAAACTTCACAAGCCCCAACGGGACCATCGAATCTCCTG
GGTTTCCTGAGAAGTATCCACACAACTTGGACTGCACCTTTACCATCCTGGCCAAACCCAAGATGGAGAT
CATCCTGCAGTTCCTGATCTTTGACCTGGAGCATGACCCTTTGCAGGTGGGAGAGGGGGACTGCAAGTAC
GATTGGCTGGACATCTGGGATGGCATTCCACATGTTGGCCCCCTGATTGGCAAGTACTGTGGGACCAAAA
CACCCTCTGAACTTCGTTCATCGACGGGGATCCTCTCCCTGACCTTTCACACGGACATGGCGGTGGCCAA
GGATGGCTTCTCTGCGCGTTACTACCTGGTCCACCAAGAGCCACTAGAGAACTTTCAGTGCAATGTTCCT
CTGGGCATGGAGTCTGGCCGGATTGCTAATGAACAGATCAGTGCCTCATCTACCTACTCTGATGGGAGGT
GGACCCCTCAACAAAGCCGGCTCCATGGTGATGACAATGGCTGGACCCCCAACTTGGATTCCAACAAGGA
GTATCTCCAGGTGGACCTGCGCTTTTTAACCATGCTCACGGCCATCGCAACACAGGGAGCGATTTCCAGG
GAAACACAGAATGGCTACTATGTCAAATCCTACAAGCTGGAAGTCAGCACTAATGGAGAGGACTGGATGG
TGTACCGGCATGGCAAAAACCACAAGGTATTTCAAGCCAACAACGATGCAACTGAGGTGGTTCTGAACAA
GCTCCACGCTCCACTGCTGACAAGGTTTGTTAGAATCCGCCCTCAGACCTGGCACTCAGGTATCGCCCTC
CGGCTGGAGCTCTTCGGCTGCCGGGTCACAGATGCTCCCTGCTCCAACATGCTGGGGATGCTCTCAGGCC
TCATTGCAGACTCCCAGATCTCCGCCTCTTCCACCCAGGAATACCTCTGGAGCCCCAGTGCAGCCCGCCT
GGTCAGCAGCCGCTCGGGCTGGTTCCCTCGAATCCCTCAGGCCCAGCCCGGTGAGGAGTGGCTTCAGGTA
GATCTGGGAACACCCAAGACAGTGAAAGGTGTCATCATCCAGGGAGCCCGCGGAGGAGACAGTATCACTG
CTGTGGAAGCCAGAGCATTTGTGCGCAAGTTCAAAGTCTCCTACAGCCTAAACGGCAAGGACTGGGAATA
CATTCAGGACCCCAGGACCCAGCAGCCAAAGCTGTTCGAAGGGAACATGCACTATGACACCCCTGACATC
CGAAGGTTTGACCCCATTCCGGCACAGTATGTGCGGGTATACCCGGAGAGGTGGTCGCCGGCGGGGATTG
GGATGCGGCTGGAGGTGCTGGGCTGTGACTGGACAGACTCCAAGCCCACGGTAGAGACGCTGGGACCCAC
TGTGAAGAGCGAAGAGACAACCACCCCCTACCCCACCGAAGAGGAGGCCACAGAGTGTGGGGAGAACTGC
AGCTTTGAGGATGACAAAGATTTGCAGCTCCCTTCGGGATTCAATTGCAACTTCGATTTCCTCGAGGAGC
CCTGTGGTTGGATGTATGACCATGCCAAGTGGCTCCGGACCACCTGGGCCAGCAGCTCCAGCCCAAACGA
CCGGACGTTTCCAGATGACAGGAATTTCTTGCGGCTGCAGAGTGACAGCCAGAGAGAGGGCCAGTATGCC
CGGCTCATCAGCCCCCCTGTCCACCTGCCCCGAAGCCCGGTGTGCATGGAGTTCCAGTACCAGGCCACGG
GCGGCCGCGGGGTGGCGCTGCAGGTGGTGCGGGAAGCCAGCCAGGAGAGCAAGTTGCTGTGGGTCATCCG
TGAGGACCAGGGCGGCGAGTGGAAGCACGGGCGGATCATCCTGCCCAGCTACGACATGGAGTACCAGATT
GTGTTCGAGGGAGTGATAGGGAAAGGACGTTCCGGAGAGATTGCCATTGATGACATTCGGATAAGCACTG
ATGTCCCACTGGAGAACTGCATGGAACCCATCTCGGCTTTTGCAGGTGAGAATTTTAAAGTGGACATCCC
AGAAATACATGAGAGAGAAGGATATGAAGATGAAATTGATGATGAATACGAGGTGGACTGGAGCAATTCT
TCTTCTGCAACCTCAGGGTCTGGCGCCCCCTCGACCGACAAAGAAAAGAGCTGGCTGTACACCCTGGATC
CCATCCTCATCACCATCATCGCCATGAGCTCACTGGGCGTCCTCCTGGGGGCCACCTGTGCAGGCCTCCT
GCTCTACTGCACCTGTTCCTACTCGGGCCTGAGCTCCCGAAGCTGCACCACACTGGAGAACTACAACTTC
GAGCTCTACGATGGCCTTAAGCACAAGGTCAAGATGAACCACCAAAAGTGCTGCTCCGAGGCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC220920 representing NM_201266
Red=Cloning site Green=Tags(s)

MTFYSPAVMNYSVPGSTSNLDGGPVRLSTSPNVLWPTSGHLSPLATHCQSSLLYAEPQKSPWCEARSLEH
TLPVNRETLKRKLSGSSCASPVTSPNAKRDAHFCPVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYIC
PATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRIVRRQRSSSEQVHCLSKAKRNGGHAPRV
KELLLSTLSPEQLVLTLLEAEPPNVLVSRPSMPFTEASMMMSLTKLADKELVHMIGWAKKIPGFVELSLL
DQVRLLESCWMEVLMVGLMWRSIDHPGKLIFAPDLVLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHK
EYLCVKAMILLNSSMYPLASANQEAESSRKLTHLLNAVTDALVWVIAKSGISSQQQSVRLANLLMLLSHV
RHISNKGMEHLLSMKCKNVVPVYDLLLEMLNAHTLRGYKSSISGSECSSTEDSKNKESSQNLQSQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_201266
ORF Size 2793 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_201266.1, NP_957718.1
RefSeq Size 6671 bp
RefSeq ORF 2796 bp
Locus ID 8828
UniProt ID O60462
Cytogenetics 2q33.3
Protein Families Druggable Genome, Transmembrane
MW 102.3 kDa
Gene Summary This gene encodes a member of the neuropilin family of receptor proteins. The encoded transmembrane protein binds to SEMA3C protein {sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3C} and SEMA3F protein {sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3F}, and interacts with vascular endothelial growth factor (VEGF). This protein may play a role in cardiovascular development, axon guidance, and tumorigenesis. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.