ApoER2 (LRP8) (NM_017522) Human Recombinant Protein
CAT#: TP320903
Recombinant protein of human low density lipoprotein receptor-related protein 8, apolipoprotein e receptor (LRP8), transcript variant 3, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220903 representing NM_017522
Red=Cloning site Green=Tags(s) MGLPEPGPLRLLALLLLLLLLLLLQLQHLAAAAADPLLGGQGPAKDCEKDQFQCRNERCIPSVWRCDEDD DCLDHSDEDDCPKKTCADSDFTCDNGHCIHERWKCDGEEECPDGSDESEATCTKQVCPAEKLSCGPTSHK CVPASWRCDGEKDCEGGADEAGCATSLGTCRGDEFQCGDGTCVLAIKHCNQEQDCPDGSDEAGCLQGLNE CLHNNGGCSHICTDLKIGFECTCPAGFQLLDQKTCGDIDECKDPDACSQICVNYKGYFKCECYPGYEMDL LTKNCKAAAGKSPSLIFTNRHEVRRIDLVKRNYSRLIPMLKNVVALDVEVATNRIYWCDLSYRKIYSAYM DKASDPKEQEVLIDEQLHSPEGLAVDWVHKHIYWTDSGNKTISVATVDGGRRRTLFSRNLSEPRAIAVDP LRGFMYWSDWGDQAKIEKSGLNGVDRQTLVSDNIEWPNGITLDLLSQRLYWVDSKLHQLSSIDFSGGNRK TLISSTDFLSHPFGIAVFEDKVFWTDLENEAIFSANRLNGLEISILAENLNNPHDIVIFHELKQPRAPDA CELSVQPNGGCEYLCLPAPQISSHSPKYTCACPDTMWLGPDMKRCYRDANEDSKMGSTVTAAVIGIIVPI VVIALLCMSGYLIWRNWKRKNTKSMNFDNPVYRKTTEEEDEDELHIGRTAQIGHVYPARVALSLEDDGLP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 74.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_059992 |
Locus ID | 7804 |
UniProt ID | Q14114 |
Cytogenetics | 1p32.3 |
Refseq Size | 6994 |
Refseq ORF | 2100 |
Synonyms | APOER2; HSZ75190; LRP-8; MCI1 |
Summary | This gene encodes a member of the low density lipoprotein receptor (LDLR) family. Low density lipoprotein receptors are cell surface proteins that play roles in both signal transduction and receptor-mediated endocytosis of specific ligands for lysosomal degradation. The encoded protein plays a critical role in the migration of neurons during development by mediating Reelin signaling, and also functions as a receptor for the cholesterol transport protein apolipoprotein E. Expression of this gene may be a marker for major depressive disorder. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jun 2011] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413735 | LRP8 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC422708 | LRP8 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY413735 | Transient overexpression lysate of low density lipoprotein receptor-related protein 8, apolipoprotein e receptor (LRP8), transcript variant 3 |
USD 665.00 |
|
LY422708 | Transient overexpression lysate of low density lipoprotein receptor-related protein 8, apolipoprotein e receptor (LRP8), transcript variant 4 |
USD 436.00 |
|
PH320903 | LRP8 MS Standard C13 and N15-labeled recombinant protein (NP_059992) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review