NFE4 (NM_001085386) Human Recombinant Protein

CAT#: TP320641L

Recombinant protein of human transcription factor NF-E4 (NF-E4), 1 mg

Product Images

Coomassie blue staining of purified NFE4 protein (Cat# TP320641). The protein was produced from HEK293T cells transfected with NFE4 cDNA clone (Cat# RC220641) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC220641 representing NM_001085386
  Red=Cloning site Green=Tags(s)
  
  LDPVPRRSAAAIALPRVVCWHTLKSLNGYKNLSSGAETREGLRSSSPVDLPLRPRKQATAAGQRKLLSLQ
  LLLCACTSVTDLTYWGPAGHGATAPHRSLLAIHLHLVPASSAAMKATGPHNAQTQVNPRGHAPSAEDPTG
  SWTVSGPCKDHPHPFLSQSNPPTRISSALPLKTDSALEQTPQQLPSLHLSQG
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 18.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001078855
• Locus ID: 58160
• Cytogenetics: 7q22.1
• Refseq Size: 967
• Refseq ORF: 576
• Synonyms: NF-E4
• Summary: The erythroid-specific protein encoded by this gene, and the ubiquitous transcription factor CP2, form the stage selector protein (SSP) complex, which is involved in preferential expression of the gamma-globin genes in fetal erythroid cells. Alternate use of an in-frame upstream non-AUG (CUG) translation initiation codon, and a downstream AUG codon, results in two isoforms. While the long isoform (22 kDa) acts as an activator, the short isoform (14 kDa) has been shown to repress gamma-globin gene expression. This gene is located in an intron of the FBXL13 gene on the opposite strand. [provided by RefSeq, Jul 2008]