Osteocalcin (BGLAP) (NM_199173) Human Recombinant Protein

CAT#: TP320555M

Recombinant protein of human bone gamma-carboxyglutamate (gla) protein (BGLAP), 100 µg

Product Images

Coomassie blue staining of purified BGLAP protein (Cat# TP320555). The protein was produced from HEK293T cells transfected with BGLAP cDNA clone (Cat# RC220555) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC220555 representing NM_199173
  Red=Cloning site Green=Tags(s)
  
  MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPR
  REVCELNPDCDELADHIGFQEAYRRFYGPV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 8.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_954642
• Locus ID: 632
• UniProt ID: P02818
• Cytogenetics: 1q22
• Refseq Size: 498
• Refseq ORF: 300
• Synonyms: BGP; OC; OCN
• Summary: This gene encodes a highly abundant bone protein secreted by osteoblasts that regulates bone remodeling and energy metabolism. The encoded protein contains a Gla (gamma carboxyglutamate) domain, which functions in binding to calcium and hydroxyapatite, the mineral component of bone. Serum osteocalcin levels may be negatively correlated with metabolic syndrome. Read-through transcription exists between this gene and the neighboring upstream gene, PMF1 (polyamine-modulated factor 1), but the encoded protein only shows sequence identity with the upstream gene product. [provided by RefSeq, Jun 2015]
• Protein Families: ES Cell Differentiation/IPS, Secreted Protein