HSPB3 (NM_006308) Human Recombinant Protein

CAT#: TP320525

Recombinant protein of human heat shock 27kDa protein 3 (HSPB3), 20 µg

Product Images

Coomassie blue staining of purified HSPB3 protein (Cat# TP320525). The protein was produced from HEK293T cells transfected with HSPB3 cDNA clone (Cat# RC220525) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC220525 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAKIILRHLIEIPVRYQEEFEARGLEDCRLDHALYALPGPTIVDLRKTRAAQSPPVDSAAETPPREGKSH
  FQILLDVVQFLPEDIIIQTFEGWLLIKAQHGTRMDEHGFISRSFTRQYKLPDGVEIKDLSAVLCHDGILV
  VEVKDPVGTK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 16.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006299
• Locus ID: 8988
• UniProt ID: Q12988, Q6ICS9
• Cytogenetics: 5q11.2
• Refseq Size: 787
• Refseq ORF: 450
• Synonyms: DHMN2C; HMN2C; HSPL27
• Summary: This gene encodes a muscle-specific small heat shock protein. A mutation in this gene is the cause of autosomal dominant distal hereditary motor neuropathy type 2C.[provided by RefSeq, Sep 2010]