HSPB3 (NM_006308) Human Recombinant Protein
CAT#: TP320525
Recombinant protein of human heat shock 27kDa protein 3 (HSPB3), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220525 protein sequence
Red=Cloning site Green=Tags(s) MAKIILRHLIEIPVRYQEEFEARGLEDCRLDHALYALPGPTIVDLRKTRAAQSPPVDSAAETPPREGKSH FQILLDVVQFLPEDIIIQTFEGWLLIKAQHGTRMDEHGFISRSFTRQYKLPDGVEIKDLSAVLCHDGILV VEVKDPVGTK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006299 |
Locus ID | 8988 |
UniProt ID | Q12988, Q6ICS9 |
Cytogenetics | 5q11.2 |
Refseq Size | 787 |
Refseq ORF | 450 |
Synonyms | DHMN2C; HMN2C; HSPL27 |
Summary | This gene encodes a muscle-specific small heat shock protein. A mutation in this gene is the cause of autosomal dominant distal hereditary motor neuropathy type 2C.[provided by RefSeq, Sep 2010] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416734 | HSPB3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY416734 | Transient overexpression lysate of heat shock 27kDa protein 3 (HSPB3) |
USD 436.00 |
|
PH320525 | HSPB3 MS Standard C13 and N15-labeled recombinant protein (NP_006299) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review