OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HSPB3 (NM_006308) Human Mass Spec Standard

Be the first to review this product
SKU
PH320525
HSPB3 MS Standard C13 and N15-labeled recombinant protein (NP_006299)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY416734 Transient overexpression lysate of heat shock 27kDa protein 3 (HSPB3) (as WB positive control) 100 ug
$436.00

Other products for "HSPB3 or NM_006308"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC220525
Predicted MW 17 kDa
Protein Sequence
Protein Sequence
>RC220525 protein sequence
Red=Cloning site Green=Tags(s)

MAKIILRHLIEIPVRYQEEFEARGLEDCRLDHALYALPGPTIVDLRKTRAAQSPPVDSAAETPPREGKSH
FQILLDVVQFLPEDIIIQTFEGWLLIKAQHGTRMDEHGFISRSFTRQYKLPDGVEIKDLSAVLCHDGILV
VEVKDPVGTK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006299
RefSeq Size 787
RefSeq ORF 450
Synonyms DHMN2C; HMN2C; HSPL27
Locus ID 8988
UniProt ID Q12988
Cytogenetics 5q11.2
Summary This gene encodes a muscle-specific small heat shock protein. A mutation in this gene is the cause of autosomal dominant distal hereditary motor neuropathy type 2C.provided by RefSeq, Sep 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HSPB3" proteins (3)
SKU Description Size Price
LC416734 Lyophilized HSPB3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416734 Transient overexpression lysate of heat shock 27kDa protein 3 (HSPB3) (as WB positive control) 100 ug
$436.00
TP320525 Recombinant protein of human heat shock 27kDa protein 3 (HSPB3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products