HSPB3 (NM_006308) Human Mass Spec Standard
CAT#: PH320525
HSPB3 MS Standard C13 and N15-labeled recombinant protein (NP_006299)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220525 |
Predicted MW | 17 kDa |
Protein Sequence |
>RC220525 protein sequence
Red=Cloning site Green=Tags(s) MAKIILRHLIEIPVRYQEEFEARGLEDCRLDHALYALPGPTIVDLRKTRAAQSPPVDSAAETPPREGKSH FQILLDVVQFLPEDIIIQTFEGWLLIKAQHGTRMDEHGFISRSFTRQYKLPDGVEIKDLSAVLCHDGILV VEVKDPVGTK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_006299 |
RefSeq Size | 787 |
RefSeq ORF | 450 |
Synonyms | DHMN2C; HMN2C; HSPL27 |
Locus ID | 8988 |
UniProt ID | Q12988, Q6ICS9 |
Cytogenetics | 5q11.2 |
Summary | This gene encodes a muscle-specific small heat shock protein. A mutation in this gene is the cause of autosomal dominant distal hereditary motor neuropathy type 2C.[provided by RefSeq, Sep 2010] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416734 | HSPB3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY416734 | Transient overexpression lysate of heat shock 27kDa protein 3 (HSPB3) |
USD 436.00 |
|
TP320525 | Recombinant protein of human heat shock 27kDa protein 3 (HSPB3), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review