CHRDL2 (NM_015424) Human Recombinant Protein

CAT#: TP320245M

Recombinant protein of human chordin-like 2 (CHRDL2), 100 µg

Product Images

CHRDL2 binds to BMP2. Co-IP of recombinant CHRDL2 protein (OriGene TP320245) and recombinant BMP2 protein and analysis in Western blot with indicated antibodies. a: BMP-2 IP with anti-CHRDL2; b: CHRDL2 IP with anti-CHRDL2; c: the mixture of BMP2 and CHRDL2; d: the mixture of BMP2 and CHRDL2 IP with anti-CHRDL2. Figure cited from Oncotarget, PMID: 28009989

• 

  Coomassie blue staining of purified CHRDL2 protein (Cat# TP320245). The protein was produced from HEK293T cells transfected with CHRDL2 cDNA clone (Cat# RC220245) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC220245 representing NM_015424
  Red=Cloning site Green=Tags(s)
  
  MVPEVRVLSSLLGLALLWFPLDSHARARPDMFCLFHGKRYSPGESWHPYLEPQGLMYCLRCTCSEGAHVS
  CYRLHCPPVHCPQPVTEPQQCCPKCVEPHTPSGLRAPPKSCQHNGTMYQHGEIFSAHELFPSRLPNQCVL
  CSCTEGQIYCGLTTCPEPGCPAPLPLPDSCCQACKDEASEQSDEEDSVQSLHGVRHPQDPCSSDAGRKRG
  PGTPAPTGLSAPLSFIPRHFRPKGAGSTTVKIVLKEKHKKACVHGGKTYSHGEVWHPAFRAFGPLPCILC
  TCEDGRQDCQRVTCPTEYPCRHPEKVAGKCCKICPEDKADPGHSEISSTRCPKAPGRVLVHTSVSPSPDN
  LRRFALEHEASDLVEIYLWKLVKDEETEAQRGEVPGPRPHSQNLPLDSDQESQEARLPERGTALPTARWP
  PRRSLERLPSPDPGAEGHGQSRQSDQDITKT
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 49.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Bioactivity: Co-immunoprecipitation (PMID: 28009989)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_056239
• Locus ID: 25884
• UniProt ID: Q6WN34
• Cytogenetics: 11q13.4
• Refseq Size: 1699
• Refseq ORF: 1353
• Synonyms: BNF1; CHL2
• Summary: This gene encodes a member of the chordin family of proteins. Chordin family members are secreted proteins that share a cysteine-rich pro-collagen repeat domain and associate with members of the transforming growth factor beta superfamily. In vitro assays demonstrate a direct interaction between the encoded protein and human activin A. This gene is expressed in many tissues including osteoblasts, where it is differentially expressed during differentiation. In addition, its expression is upregulated in human osteoarthritic joint cartilage, suggesting a role in adult cartilage regeneration. [provided by RefSeq, Jan 2015]
• Protein Families: Secreted Protein