SYCE1 (NM_130784) Human Recombinant Protein

CAT#: TP320187M

Purified recombinant protein of Homo sapiens synaptonemal complex central element protein 1 (SYCE1), transcript variant 1, 100 µg

Product Images

Coomassie blue staining of purified SYCE1 protein (Cat# TP320187). The protein was produced from HEK293T cells transfected with SYCE1 cDNA clone (Cat# RC220187) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC220187 representing NM_130784
  Red=Cloning site Green=Tags(s)
  
  MEMVQKLQKVGSLEPRVEVLINRINEVQQAKKKANKDLGEARTICEALQKELDSLHGEKVHLKEILSKKQ
  ETLRILRLHCQEKESEAHRKHTMLQECKERISALNLQIEEEKNKQRQLRLAFEEQLEDLMGQHKDLWDFH
  MPERLAKEICALDSSKEQLLKEEKLVKATLEDVKHQLCSLCGAEGPSTLDEGLFLRSQEAAATVQLFQEE
  HRKAEELLAAAAQRHQQLQQKCQQQQQKRQRLKEELEKHGMQVPAQAQSTQEEEAGPGDVAPRPGRPVTW
  WS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 32.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_570140
• Locus ID: 93426
• UniProt ID: Q8N0S2
• Cytogenetics: 10q26.3
• Refseq Size: 1400
• Refseq ORF: 846
• Synonyms: C10orf94; CT76; POF12; SPGF15
• Summary: This gene encodes a member of the synaptonemal complex, which links homologous chromosomes during prophase I of meiosis. The tripartite structure of the complex is highly conserved amongst metazoans. It consists of two lateral elements and a central region formed by transverse elements and a central element. The protein encoded by this gene localizes to the central element and is required for initiation and elongation of the synapsis. Allelic variants of this gene have been associated with premature ovarian failure and spermatogenic failure. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2016]