PBR (TSPO) (NM_000714) Human Recombinant Protein

CAT#: TP320107

Reviews ()
Write a review

Recombinant protein of human translocator protein (18kDa) (TSPO), transcript variant PBR

Size: 20 ug 100 ug 1 mg



USD 867.00

In Stock*

Size
    • 20 ug

Product images

Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 412.00


Goat Polyclonal Antibody against TSPO
    • 100 ug

USD 465.00

Other products for "TSPO"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC220107 protein sequence
Red=Cloning site Green=Tags(s)

MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKE
LGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPY
LAWLAFATTLNYCVWRDNHGWHGGRRLPE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 18.6 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Bioactivity Surface Plasmon Ressonance (SPR) (PMID: 27855359)
Surface Plasmon Ressonance (SPR) (PMID: 29031071)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_000705
Locus ID 706
UniProt ID P30536, O76068
Cytogenetics 22q13.2
Refseq Size 921
Refseq ORF 507
Synonyms BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS; pk18; PKBS; PTBR
Summary Present mainly in the mitochondrial compartment of peripheral tissues, the protein encoded by this gene interacts with some benzodiazepines and has different affinities than its endogenous counterpart. The protein is a key factor in the flow of cholesterol into mitochondria to permit the initiation of steroid hormone synthesis. Alternatively spliced transcript variants have been reported; one of the variants lacks an internal exon and is considered non-coding, and the other variants encode the same protein. [provided by RefSeq, Feb 2012]
Protein Families Druggable Genome, Transmembrane
Protein Pathways Neuroactive ligand-receptor interaction

Documents

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.