ZFYVE27 (NM_001002261) Human Recombinant Protein
CAT#: TP319897
Recombinant protein of human zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219897 representing NM_001002261
Red=Cloning site Green=Tags(s) MQTSEREGSGPELSPSVMPEAPLESPPFPTKSPAFDLFNLVLSYKRLEIYLEPLKDAGDGVRYLLRWQMP LCSLLTCLGLNVLFLTLNEGAWYSVGALMISVPALLGYLQEVCRARLPDSELMRRKYHSVRQEDLQRGRL SRPEAVAEVKSFLIQLEAFLSRLCCTCEAAYRVLHWENPVVSSQFYGALLGTVCMLYLLPLCWVLTLLNS TLFLGNVEFFRVVSEYRASLQQRMNPKQEEHAFESPPPPDVGGKDGLMDSTPALTPTESLSSQDLTPGSV EEAEEAEPDEEFKDAIEETHLVVLEDDEGAPCPAEDELALQDNGFLSKNEVLRSKVSRLTERLRKRYPTN NFGNCTGCSATFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASCNQTLSK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 46.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001002261 |
Locus ID | 118813 |
UniProt ID | Q5T4F4 |
Cytogenetics | 10q24.2 |
Refseq Size | 3045 |
Refseq ORF | 1248 |
Synonyms | PROTRUDIN; SPG33 |
Summary | This gene encodes a protein with several transmembrane domains, a Rab11-binding domain and a lipid-binding FYVE finger domain. The encoded protein appears to promote neurite formation. A mutation in this gene has been reported to be associated with hereditary spastic paraplegia, however the pathogenicity of the mutation, which may simply represent a polymorphism, is unclear. [provided by RefSeq, Mar 2010] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403394 | ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC424194 | ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC424195 | ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC432830 | ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC432865 | ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC432877 | ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC432956 | ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY403394 | Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 2 |
USD 436.00 |
|
LY424194 | Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 1 |
USD 665.00 |
|
LY424195 | Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 3 |
USD 436.00 |
|
LY432830 | Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 7 |
USD 436.00 |
|
LY432865 | Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 6 |
USD 436.00 |
|
LY432877 | Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 5 |
USD 436.00 |
|
LY432956 | Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 4 |
USD 436.00 |
|
PH306193 | ZFYVE27 MS Standard C13 and N15-labeled recombinant protein (NP_653189) |
USD 3,255.00 |
|
PH319897 | ZFYVE27 MS Standard C13 and N15-labeled recombinant protein (NP_001002261) |
USD 3,255.00 |
|
TP306193 | Recombinant protein of human zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 2, 20 µg |
USD 867.00 |
|
TP329865 | Purified recombinant protein of Homo sapiens zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 6, 20 µg |
USD 867.00 |
|
TP329877 | Purified recombinant protein of Homo sapiens zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 5, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review