TCEAL1 (NM_004780) Human Recombinant Protein
CAT#: TP319873
Recombinant protein of human transcription elongation factor A (SII)-like 1 (TCEAL1), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219873 protein sequence
Red=Cloning site Green=Tags(s) MDKPRKENEEEPQSAPKTDEERPPVEHSPEKQSPEEQSSEEQSSEEEFFPEELLPELLPEMLLSEERPPQ EGLSRKDLFEGRPPMEQPPCGVGKHKLEEGSFKERLARSRPQFRGDIHGRNLSNEEMIQAADELEEMKRV RNKLMIMHWKAKRSRPYPI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004771 |
Locus ID | 9338 |
UniProt ID | Q15170 |
Cytogenetics | Xq22.2 |
Refseq Size | 1220 |
Refseq ORF | 477 |
Synonyms | p21; pp21; SIIR; WEX9 |
Summary | This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. The encoded protein is similar to transcription elongation factor A/transcription factor SII and contains a zinc finger-like motif as well as a sequence related to the transcription factor SII Pol II-binding region. It may exert its effects via protein-protein interactions with other transcriptional regulators rather than via direct binding of DNA. Multiple family members are located on the X chromosome. Alternative splicing results in multiple transcript variants encoding a single isoform. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417752 | TCEAL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC423535 | TCEAL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC423536 | TCEAL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY417752 | Transient overexpression lysate of transcription elongation factor A (SII)-like 1 (TCEAL1), transcript variant 1 |
USD 436.00 |
|
LY423535 | Transient overexpression lysate of transcription elongation factor A (SII)-like 1 (TCEAL1), transcript variant 2 |
USD 436.00 |
|
LY423536 | Transient overexpression lysate of transcription elongation factor A (SII)-like 1 (TCEAL1), transcript variant 3 |
USD 436.00 |
|
PH319873 | TCEAL1 MS Standard C13 and N15-labeled recombinant protein (NP_004771) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review