SMAGP (NM_001031628) Human Recombinant Protein
CAT#: TP318509
Recombinant protein of human small trans-membrane and glycosylated protein (LOC57228), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218509 protein sequence
Red=Cloning site Green=Tags(s) MTSLLTTPSPREELMTTPILQPTEALSPEDGASTALIAVVITVVFLTLLSVVILIFFYLYKNKGSYVTYE PTEGEPSAIVQMESDLAKGSEKEEYFI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001026798 |
Locus ID | 57228 |
UniProt ID | Q0VAQ4 |
Cytogenetics | 12q13.13 |
Refseq Size | 1087 |
Refseq ORF | 291 |
Synonyms | hSMAGP |
Summary | May play a role in epithelial cell-cell contacts. May play a role in tumor invasiveness and metastasis formation.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422217 | SMAGP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC422425 | SMAGP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY422217 | Transient overexpression lysate of small cell adhesion glycoprotein (SMAGP), transcript variant 1 |
USD 436.00 |
|
LY422425 | Transient overexpression lysate of small cell adhesion glycoprotein (SMAGP), transcript variant 2 |
USD 436.00 |
|
PH303589 | SMAGP MS Standard C13 and N15-labeled recombinant protein (NP_001029045) |
USD 3,255.00 |
|
PH318509 | SMAGP MS Standard C13 and N15-labeled recombinant protein (NP_001026798) |
USD 3,255.00 |
|
TP303589 | Recombinant protein of human small trans-membrane and glycosylated protein (LOC57228), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review