CDYL (NM_170752) Human Recombinant Protein

CAT#: TP317438

Recombinant protein of human chromodomain protein, Y-like (CDYL), transcript variant 3, 20 µg

Product Images

Coomassie blue staining of purified CDYL protein (Cat# TP317438). The protein was produced from HEK293T cells transfected with CDYL cDNA clone (Cat# RC217438) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC217438 representing NM_170752
  Red=Cloning site Green=Tags(s)
  
  MDALTANGTTNIQTSVTGVTASKRKFIDDRRDQPFDKRLRFSVRQTESAYRYRDIVVRKQDGFTHILLST
  KSSENNSLNPEVMREVQSALSTAAADDSKLVLLSAVGSVFCCGLDFIYFIRRLTDDRKRESTKMAEAIRN
  FVNTFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQSPDGCSTVMFPKIMGGASA
  NEMLLSGRKLTAQEACGKGLVSQVFWPGTFTQEVMVRIKELASCNPVVLEESKALVRCNMKMELEQANER
  ECEVLKKIWGSAQGTDSMLKYMQRKIDEF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 34.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_736608
• Locus ID: 9425
• UniProt ID: Q9Y232
• Cytogenetics: 6p25.1
• Refseq Size: 2805
• Refseq ORF: 927
• Synonyms: CDYL1, MGC131936, DKFZp586C1622
• Summary: Chromodomain Y is a primate-specific Y-chromosomal gene family expressed exclusively in the testis and implicated in infertility. Although the Y-linked genes are testis-specific, this autosomal gene is ubiquitously expressed. The Y-linked genes arose by retrotransposition of an mRNA from this gene, followed by amplification of the retroposed gene. Proteins encoded by this gene superfamily possess a chromodomain, a motif implicated in chromatin binding and gene suppression, and a catalytic domain believed to be involved in histone acetylation. Multiple proteins are encoded by transcript variants of this gene. [provided by RefSeq, Jul 2008]