SKAP55 (SKAP1) (NM_003726) Human Recombinant Protein

CAT#: TP317083M

Recombinant protein of human src kinase associated phosphoprotein 1 (SKAP1), transcript variant 1, 100 µg

Product Images

Coomassie blue staining of purified SKAP1 protein (Cat# TP317083). The protein was produced from HEK293T cells transfected with SKAP1 cDNA clone (Cat# RC217083) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC217083 representing NM_003726
  Red=Cloning site Green=Tags(s)
  
  MQAAALPEEIRWLLEDAEEFLAEGLRNENLSAVARDHRDHILRGFQQIKARYYWDFQPQGGDIGQDSSDD
  NHSGTLGLSLTSDAPFLSDYQDEGMEDIVKGAQELDNVIKQGYLEKKSKDHSFFGSEWQKRWCVVSRGLF
  YYYANEKSKQPKGTFLIKGYSVRMAPHLRRDSKKESCFELTSQDRRSYEFTATSPAEARDWVDQISFLLK
  DLSSLTIPYEEDEEEEEKEETYDDIDGFDSPSCGSQCRPTILPGSVGIKEPTEEKEEEDIYEVLPDEEHD
  LEEDESGTRRKGVDYASYYQGLWDCHGDQPDELSFQRGDLIRILSKEYNMYGWWVGELNSLVGIVPKEYL
  TTAFEVEER
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 41.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003717
• Locus ID: 8631
• UniProt ID: Q86WV1
• Cytogenetics: 17q21.32
• Refseq Size: 1531
• Refseq ORF: 1077
• Synonyms: HEL-S-81p; SCAP1; SKAP55
• Summary: This gene encodes a T cell adaptor protein, a class of intracellular molecules with modular domains capable of recruiting additional proteins but that exhibit no intrinsic enzymatic activity. The encoded protein contains a unique N-terminal region followed by a PH domain and C-terminal SH3 domain. Along with the adhesion and degranulation-promoting adaptor protein, the encoded protein plays a critical role in inside-out signaling by coupling T-cell antigen receptor stimulation to the activation of integrins. [provided by RefSeq, Jul 2008]