PCYT1B (NM_004845) Human Recombinant Protein

CAT#: TP316978L

Recombinant protein of human phosphate cytidylyltransferase 1, choline, beta (PCYT1B), 1 mg

Product Images

Coomassie blue staining of purified PCYT1B protein (Cat# TP316978). The protein was produced from HEK293T cells transfected with PCYT1B cDNA clone (Cat# RC216978) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC216978 representing NM_004845
  Red=Cloning site Green=Tags(s)
  
  MPVVTTDAESETGIPKSLSNEPPSETMEEIEHTCPQPRLTLTAPAPFADETNCQCQAPHEKLTIAQARLG
  TPADRPVRVYADGIFDLFHSGHARALMQAKTLFPNSYLLVGVCSDDLTHKFKGFTVMNEAERYEALRHCR
  YVDEVIRDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDDVYKHIKEAGMFVPTQRTEGISTSDIITRIV
  RDYDVYARRNLQRGYTAKELNVSFINEKRYRFQNQVDKMKEKVKNVEERSKEFVNRVEEKSHDLIQKWEE
  KSREFIGNFLELFGPDGAWKQMFQERSSRMLQALSPKQSPVSSPTRSRSPSRSPSPTFSWLPLKTSPPSS
  PKAASASISSMSEGDEDEK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 41.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004836
• Locus ID: 9468
• UniProt ID: Q9Y5K3
• Cytogenetics: Xp22.11
• Refseq Size: 5447
• Refseq ORF: 1107
• Synonyms: CCTB; CTB
• Summary: The protein encoded by this gene belongs to the cytidylyltransferase family. It is involved in the regulation of phosphatidylcholine biosynthesis. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]
• Protein Families: Stem cell - Pluripotency
• Protein Pathways: Glycerophospholipid metabolism, Metabolic pathways