A1CF (NM_138932) Human Recombinant Protein
CAT#: TP316861
Recombinant protein of human APOBEC1 complementation factor (A1CF), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC216861 protein sequence
Red=Cloning site Green=Tags(s) MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDAAPPERGCEIFIGKLPRDLFED ELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYEIRNGRLLGVCASVDNCRLFV GGIPKTKKREEILSEMKKVTEGVVDVIVYPSAADKTKNRGFAFVEYESHRAAAMARRKLLPGRIQLWGHG IAVDWAEPEVEVDEDTMSSVKILYVRNLMLSTSEEMIEKEFNNIKPGAVERVKKIRDYAFVHFSNREDAV EAMKALNGKVLDGSPIEVTLAKPVDKDSYVRYTRGTGGRGTMLQGEYTYSLGQVYDPTTTYLGAPVFYAP QTYAAIPSLHFPATKGHLSNRAIIRAPSVREIYMNVPVGAAGVRGLGGRGYLAYTGLGRGYQVKGDKRED KLYDILPGMELTPMNPVTLKPQGIKLAPQILEEICQKNNWGQPVYQLHSAIGQDQRQLFLYKITIPALAS QNPAIHPFTPPKLSAFVDEAKTYAAEYTLQTLGIPTDGGDGTMATAAAAATAFPGYAVPNATAPVSAAQL KQAVTLGQDLAAYTTYEVYPTFAVTARGDGYGTF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 65 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_620310 |
Locus ID | 29974 |
UniProt ID | Q9NQ94, A0A024QZM7 |
Cytogenetics | 10q11.23 |
Refseq Size | 9293 |
Refseq ORF | 1782 |
Synonyms | ACF; ACF64; ACF65; APOBEC1CF; ASP |
Summary | Mammalian apolipoprotein B mRNA undergoes site-specific C to U deamination, which is mediated by a multi-component enzyme complex containing a minimal core composed of APOBEC-1 and a complementation factor encoded by this gene. The gene product has three non-identical RNA recognition motifs and belongs to the hnRNP R family of RNA-binding proteins. It has been proposed that this complementation factor functions as an RNA-binding subunit and docks APOBEC-1 to deaminate the upstream cytidine. Studies suggest that the protein may also be involved in other RNA editing or RNA processing events. Several transcript variants encoding a few different isoforms have been found for this gene. [provided by RefSeq, Nov 2010] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408475 | A1CF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC408476 | A1CF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC415195 | A1CF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LY408475 | Transient overexpression lysate of APOBEC1 complementation factor (A1CF), transcript variant 2 |
USD 665.00 |
|
LY408476 | Transient overexpression lysate of APOBEC1 complementation factor (A1CF), transcript variant 3 |
USD 665.00 |
|
LY415195 | Transient overexpression lysate of APOBEC1 complementation factor (A1CF), transcript variant 1 |
USD 665.00 |
|
PH316861 | A1CF MS Standard C13 and N15-labeled recombinant protein (NP_620310) |
USD 3,255.00 |
|
PH316911 | A1CF MS Standard C13 and N15-labeled recombinant protein (NP_620311) |
USD 3,255.00 |
|
TP316911 | Recombinant protein of human APOBEC1 complementation factor (A1CF), transcript variant 3, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review