TBX5 (NM_000192) Human Recombinant Protein
CAT#: TP316520
Recombinant protein of human T-box 5 (TBX5), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC216520 representing NM_000192
Red=Cloning site Green=Tags(s) MADADEGFGLAHTPLEPDAKDLPCDSKPESALGAPSKSPSSPQAAFTQQGMEGIKVFLHERELWLKFHEV GTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNKWSVTGKAEPAMPGRLYVHPD SPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNGFGSKNTAFCTHVFPETA FIAVTSYQNHKITQLKIENNPFAKGFRGSDDMELHRMSRMQSKEYPVVPRSTVRQKVASNHSPFSSESRA LSTSSNLGSQYQCENGVSGPSQDLLPPPNPYPLPQEHSQIYHCTKRKEEECSTTDHPYKKPYMETSPSEE DSFYRSSYPQQQGLGASYRTESAQRQACMYASSAPPSEPVPSLEDISCNTWPSMPSYSSCTVTTVQPMDR LPYQHFSAHFTSGPLVPRLAGMANHGSPQLGEGMFQHQTSVAHQPVVRQCGPQTGLQSPGTLQPPEFLYS HGVPRTLSPHQYHSVHGVGMVPEWSDNS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 57.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000183 |
Locus ID | 6910 |
UniProt ID | Q99593 |
Cytogenetics | 12q24.21 |
Refseq Size | 3921 |
Refseq ORF | 1554 |
Synonyms | HOS |
Summary | This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is closely linked to related family member T-box 3 (ulnar mammary syndrome) on human chromosome 12. The encoded protein may play a role in heart development and specification of limb identity. Mutations in this gene have been associated with Holt-Oram syndrome, a developmental disorder affecting the heart and upper limbs. Several transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400071 | TBX5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC403620 | TBX5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LY400071 | Transient overexpression lysate of T-box 5 (TBX5), transcript variant 1 |
USD 436.00 |
|
LY403620 | Transient overexpression lysate of T-box 5 (TBX5), transcript variant 4 |
USD 665.00 |
|
PH316520 | TBX5 MS Standard C13 and N15-labeled recombinant protein (NP_000183) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review