RAD1 (NM_002853) Human Recombinant Protein

CAT#: TP316420

Recombinant protein of human RAD1 homolog (S. pombe) (RAD1), transcript variant 1, 20 µg

Product Images

Coomassie blue staining of purified RAD1 protein (Cat# TP316420). The protein was produced from HEK293T cells transfected with RAD1 cDNA clone (Cat# RC216420) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC216420 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPLLTQQIQDEDDQYSLVASLDNVRNLSTILKAIHFREHATCFATKNGIKVTVENAKCVQANAFIQAGIF
  QEFKVQEESVTFRINLTVLLDCLSIFGSSPMPGTLTALRMCYQGYGYPLMLFLEEGGVVTVCKINTQEPE
  ETLDFDFCSTNVINKIILQSEGLREAFSELDMTSEVLQITMSPDKPYFRLSTFGNAGSSHLDYPKDSDLM
  EAFHCNQTQVNRYKISLLKPSTKALVLSCKVSIRTDNRGFLSLQYMIRNEDGQICFVEYYCCPDEEVPES
  ES
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 31.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002844
• Locus ID: 5810
• UniProt ID: O60671, A0A024R045
• Cytogenetics: 5p13.2
• Refseq Size: 4683
• Refseq ORF: 846
• Synonyms: HRAD1; REC1
• Summary: This gene encodes a component of a heterotrimeric cell cycle checkpoint complex, known as the 9-1-1 complex, that is activated to stop cell cycle progression in response to DNA damage or incomplete DNA replication. The 9-1-1 complex is recruited by RAD17 to affected sites where it may attract specialized DNA polymerases and other DNA repair effectors. Alternatively spliced transcript variants of this gene have been described. [provided by RefSeq, Jan 2009]
• Protein Families: Druggable Genome