RAD1 (NM_002853) Human Recombinant Protein
CAT#: TP316420
Recombinant protein of human RAD1 homolog (S. pombe) (RAD1), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC216420 protein sequence
Red=Cloning site Green=Tags(s) MPLLTQQIQDEDDQYSLVASLDNVRNLSTILKAIHFREHATCFATKNGIKVTVENAKCVQANAFIQAGIF QEFKVQEESVTFRINLTVLLDCLSIFGSSPMPGTLTALRMCYQGYGYPLMLFLEEGGVVTVCKINTQEPE ETLDFDFCSTNVINKIILQSEGLREAFSELDMTSEVLQITMSPDKPYFRLSTFGNAGSSHLDYPKDSDLM EAFHCNQTQVNRYKISLLKPSTKALVLSCKVSIRTDNRGFLSLQYMIRNEDGQICFVEYYCCPDEEVPES ES myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002844 |
Locus ID | 5810 |
UniProt ID | O60671, A0A024R045 |
Cytogenetics | 5p13.2 |
Refseq Size | 4683 |
Refseq ORF | 846 |
Synonyms | HRAD1; REC1 |
Summary | This gene encodes a component of a heterotrimeric cell cycle checkpoint complex, known as the 9-1-1 complex, that is activated to stop cell cycle progression in response to DNA damage or incomplete DNA replication. The 9-1-1 complex is recruited by RAD17 to affected sites where it may attract specialized DNA polymerases and other DNA repair effectors. Alternatively spliced transcript variants of this gene have been described. [provided by RefSeq, Jan 2009] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403338 | RAD1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC419081 | RAD1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY403338 | Transient overexpression lysate of RAD1 homolog (S. pombe) (RAD1), transcript variant 3 |
USD 436.00 |
|
LY419081 | Transient overexpression lysate of RAD1 homolog (S. pombe) (RAD1), transcript variant 1 |
USD 436.00 |
|
PH316420 | RAD1 MS Standard C13 and N15-labeled recombinant protein (NP_002844) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review