DUSP15 (NM_177991) Human Recombinant Protein

CAT#: TP316271L

Recombinant protein of human dual specificity phosphatase 15 (DUSP15), transcript variant 2, 1 mg

Product Images

Coomassie blue staining of purified DUSP15 protein (Cat# TP316271). The protein was produced from HEK293T cells transfected with DUSP15 cDNA clone (Cat# RC216271) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC216271 representing NM_177991
  Red=Cloning site Green=Tags(s)
  
  MTVTGLGWRDVLEAIKATRPIANPNPGFRQQLEEFGWASSQKLRRQLEERFGESPFRDEEELRALLPLCK
  RCRQGSATSASSAGPHSAASEGTVQRLVPRTPREAHRPLPLLARVKQTFSCLPRCLSRKGGK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 14.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_817130
• Locus ID: 128853
• UniProt ID: Q9H1R2
• Cytogenetics: 20q11.21
• Refseq Size: 1184
• Refseq ORF: 396
• Synonyms: C20orf57; VHY
• Summary: The protein encoded by this gene has both protein-tyrosine phophatase activity and serine/threonine-specific phosphatase activity, and therefore is known as a dual specificity phosphatase. This protein may function in the differentiation of oligodendrocytes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]
• Protein Families: Druggable Genome, Phosphatase