SH3KBP1 (NM_001024666) Human Recombinant Protein
CAT#: TP315701
Recombinant protein of human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215701 representing NM_001024666
Red=Cloning site Green=Tags(s) MEVSAAKAPSAADLSEIEIKKEMKKDPLTNKAPEKPLHEVPSGNSLLSSETILRTNKRGERRRRRCQVAF SYLPQNDDELELKVGDIIEVVGEVEEGWWEGVLNGKTGMFPSNFIKELSGESDELGISQDEQLSKSSLRE TTGSESDGGDSSSTKSEGANGTVATAAIQPKKVKGVGFGDIFKDKPIKLRPRSIEVENDFLPVEKTIGKK LPATTATPDSSKTEMDSRTKSKDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWEGELNGRRGV FPDNFVKLLPPDFEKEGNRPKKPPPPSAPVIKQGAGTTERKHEIKKIPPERPEMLPNRTEEKERPEREPK LDLQKPSVPAIPPKKPRPPKTNSLSRPGALPPRRPERPVGPLTHTRGDSPKIDLAGSSLSGILDKDLSDR SNDIDLEGFDSVVSSTEKLSHPTTSRPKATGRRPPSQSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGV DASKKTSKTVTISQVSDNKASLPPKPGTMAAGGGGPAPLSSAAPSPLSSSLGTAGHRANSPSLFGTEGKP KMEPAASSQAAVEELRTQVRELRSIIETMKDQQKREIKQLLSELDEEKKIRLRLQMEVNDIKKALQSK TRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 68.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001019837 |
Locus ID | 30011 |
UniProt ID | Q96B97 |
Cytogenetics | Xp22.12 |
Refseq Size | 2689 |
Refseq ORF | 1884 |
Synonyms | AGMX2; CD2BP3; CIN85; GIG10; HSB-1; HSB1; IMD61; MIG18 |
Summary | This gene encodes an adapter protein that contains one or more N-terminal Src homology domains, a proline rich region and a C-terminal coiled-coil domain. The encoded protein facilitates protein-protein interactions and has been implicated in numerous cellular processes including apoptosis, cytoskeletal rearrangement, cell adhesion and in the regulation of clathrin-dependent endocytosis. Alternate splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2017] |
Protein Families | Druggable Genome |
Protein Pathways | Endocytosis |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410454 | SH3KBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC422529 | SH3KBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LY410454 | Transient overexpression lysate of SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 1 |
USD 436.00 |
|
LY422529 | Transient overexpression lysate of SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 2 |
USD 665.00 |
|
PH302186 | SH3KBP1 MS Standard C13 and N15-labeled recombinant protein (NP_114098) |
USD 3,255.00 |
|
PH315701 | SH3KBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001019837) |
USD 3,255.00 |
|
TP302186 | Recombinant protein of human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review