FUBP1 (NM_003902) Human Recombinant Protein

CAT#: TP315674

Recombinant protein of human far upstream element (FUSE) binding protein 1 (FUBP1), 20 µg

Product Images

FUBP1 binds to the wild-type (wt) RNA probe that contains site O. The O-WT or mutated (O-mut, UGU-mut) biotinylated RNA probes (20 fmol) were incubated for 30 min at room temperature with 200 nM of recombinant FUBP1 protein (OriGene TP315674) and resolved on a 5% native polyacrylamide gel. The arrow indicates band-shifted complexes. For the competition assay, an excess of unlabeled O-WT RNA probe (200 pmol) was added. Figure cited from Nucleic Acids Res, PMID: 25662218

• 

  Coomassie blue staining of purified FUBP1 protein (Cat# TP315674). The protein was produced from HEK293T cells transfected with FUBP1 cDNA clone (Cat# RC215674) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC215674 representing NM_003902
  Red=Cloning site Green=Tags(s)
  
  MADYSTVPPPSSGSAGGGGGGGGGGGVNDAFKDALQRARQIAAKIGGDAGTSLNSNDYGYGGQKRPLEDG
  DQPDAKKVAPQNDSFGTQLPPMHQQQSRSVMTEEYKVPDGMVGFIIGRGGEQISRIQQESGCKIQIAPDS
  GGLPERSCMLTGTPESVQSAKRLLDQIVEKGRPAPGFHHGDGPGNAVQEIMIPASKAGLVIGKGGETIKQ
  LQERAGVKMVMIQDGPQNTGADKPLRITGDPYKVQQAKEMVLELIRDQGGFREVRNEYGSRIGGNEGIDV
  PIPRFAVGIVIGRNGEMIKKIQNDAGVRIQFKPDDGTTPERIAQITGPPDRCQHAAEIITDLLRSVQAGN
  PGGPGPGGRGRGRGQGNWNMGPPGGLQEFNFIVPTGKTGLIIGKGGETIKSISQQSGARIELQRNPPPNA
  DPNMKLFTIRGTPQQIDYARQLIEEKIGGPVNPLGPPVPHGPHGVPGPHGPPGPPGPGTPMGPYNPAPYN
  PGPPGPAPHGPPAPYAPQGWGNAYPHWQQQAPPDPAKAGTDPNSAAWAAYYAHYYQQQAQPPPAAPAGAP
  TTTQTNGQGDQQNPAPAGQVDYTKAWEEYYKKMGQAVPAPTGAPPGGQPDYSAAWAEYYRQQAAYYAQTS
  PQGMPQHPPAPQGQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 67.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Bioactivity: EMSA assay (PMID: 25662218)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003893
• Locus ID: 8880
• UniProt ID: Q96AE4
• Cytogenetics: 1p31.1
• Refseq Size: 2884
• Refseq ORF: 1932
• Synonyms: FBP; FUBP; hDH V
• Summary: The protein encoded by this gene is a single stranded DNA-binding protein that binds to multiple DNA elements, including the far upstream element (FUSE) located upstream of c-myc. Binding to FUSE occurs on the non-coding strand, and is important to the regulation of c-myc in undifferentiated cells. This protein contains three domains, an amphipathic helix N-terminal domain, a DNA-binding central domain, and a C-terminal transactivation domain that contains three tyrosine-rich motifs. The N-terminal domain is thought to repress the activity of the C-terminal domain. This protein is also thought to bind RNA, and contains 3'-5' helicase activity with in vitro activity on both DNA-DNA and RNA-RNA duplexes. Aberrant expression of this gene has been found in malignant tissues, and this gene is important to neural system and lung development. Binding of this protein to viral RNA is thought to play a role in several viral diseases, including hepatitis C and hand, foot and mouth disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2014]
• Protein Families: Stem cell - Pluripotency, Transcription Factors