DAPP1 (NM_014395) Human Recombinant Protein

CAT#: TP315474L

Recombinant protein of human dual adaptor of phosphotyrosine and 3-phosphoinositides (DAPP1), 1 mg

Product Images

Coomassie blue staining of purified DAPP1 protein (Cat# TP315474). The protein was produced from HEK293T cells transfected with DAPP1 cDNA clone (Cat# RC215474) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC215474 representing NM_014395
  Red=Cloning site Green=Tags(s)
  
  MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLY
  SLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYE
  SVRVHTAMQTGRTEDDLVPTAPSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDL
  TECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIRKQLNQGEGTIRSRSFIFK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 32 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_055210
• Locus ID: 27071
• UniProt ID: Q9UN19
• Cytogenetics: 4q23
• Refseq Size: 2953
• Refseq ORF: 840
• Synonyms: BAM32
• Summary: May act as a B-cell-associated adapter that regulates B-cell antigen receptor (BCR)-signaling downstream of PI3K.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Phosphatase
• Protein Pathways: B cell receptor signaling pathway