IGFL1 (NM_198541) Human Recombinant Protein

CAT#: TP315281

Reviews ()
Write a review

Recombinant protein of human IGF-like family member 1 (IGFL1)



Special Offer: 30% off on this product. Use code "Pro30".

USD 867.00


Availability*
In Stock

Size
    • 20 ug


Product images

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC215281 representing NM_198541
Red=Cloning site Green=Tags(s)

MAPRGCIVAVFAIFCISRLLCSHGAPVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCG
NCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 12.2 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_940943
Locus ID 374918
UniProt ID Q6UW32
Cytogenetics 19q13.32
Refseq Size 771
Refseq ORF 330
Synonyms APRG644; UNQ644
Summary The protein encoded by this gene is a member of the insulin-like growth factor family of signaling molecules. The encoded protein is synthesized as a precursor protein and is proteolytically cleaved to form a secreted mature peptide. The mature peptide binds to a receptor, which in mouse was found on the cell surface of T cells. Increased expression of this gene may be linked to psoriasis. [provided by RefSeq, Aug 2016]
Protein Families Secreted Protein, Transmembrane

Documents

Other products for "IGFL1"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.