IGFL1 (NM_198541) Human Recombinant Protein
CAT#: TP315281
Recombinant protein of human IGF-like family member 1 (IGFL1), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215281 representing NM_198541
Red=Cloning site Green=Tags(s) MAPRGCIVAVFAIFCISRLLCSHGAPVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCG NCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 12.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_940943 |
Locus ID | 374918 |
UniProt ID | Q6UW32 |
Cytogenetics | 19q13.32 |
Refseq Size | 771 |
Refseq ORF | 330 |
Synonyms | APRG644; UNQ644 |
Summary | The protein encoded by this gene is a member of the insulin-like growth factor family of signaling molecules. The encoded protein is synthesized as a precursor protein and is proteolytically cleaved to form a secreted mature peptide. The mature peptide binds to a receptor, which in mouse was found on the cell surface of T cells. Increased expression of this gene may be linked to psoriasis. [provided by RefSeq, Aug 2016] |
Protein Families | Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403685 | IGFL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY403685 | Transient overexpression lysate of IGF-like family member 1 (IGFL1) |
USD 436.00 |
|
PH315281 | IGFL1 MS Standard C13 and N15-labeled recombinant protein (NP_940943) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review