SPRR2A (NM_005988) Human Recombinant Protein

CAT#: TP315197L

Recombinant protein of human small proline-rich protein 2A (SPRR2A), 1 mg

Product Images

Coomassie blue staining of purified SPRR2A protein (Cat# TP315197). The protein was produced from HEK293T cells transfected with SPRR2A cDNA clone (Cat# RC215197) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC215197 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQSKYPPK
  SK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 7.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005979
• Locus ID: 6700
• UniProt ID: P35326
• Cytogenetics: 1q21.3
• Refseq Size: 692
• Refseq ORF: 216
• Summary: Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.[UniProtKB/Swiss-Prot Function]