beta Synuclein (SNCB) (NM_001001502) Human Recombinant Protein

CAT#: TP315165

Recombinant protein of human synuclein, beta (SNCB), transcript variant 1, 20 µg

Product Images

Coomassie blue staining of purified SNCB protein (Cat# TP315165). The protein was produced from HEK293T cells transfected with SNCB cDNA clone (Cat# RC215165) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC215165 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAV
  FSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 14.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001001502
• Locus ID: 6620
• UniProt ID: Q16143
• Cytogenetics: 5q35.2
• Refseq Size: 1467
• Refseq ORF: 402
• Summary: This gene encodes a member of a small family of proteins that inhibit phospholipase D2 and may function in neuronal plasticity. The encoded protein is abundant in lesions of patients with Alzheimer disease. A mutation in this gene was found in individuals with dementia with Lewy bodies. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]