ANKRD16 (NM_001009941) Human Recombinant Protein
CAT#: TP315131
Recombinant protein of human ankyrin repeat domain 16 (ANKRD16), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215131 protein sequence
Red=Cloning site Green=Tags(s) MAQPGDPRRLCRLVQEGRLRALKEELQAAGGCPGPAGDTLLHCAARHGHRDVLAYLAEAWGMDIEATNRD YKRPLHEAASMGHRDCVRYLLGRGAAVDCLKKADWTPLMMACTRKNLGVIQELVEHGANPLLKNKDGWNS FHIASREGDPLILQYLLTVCPGAWKTESKIRRTPLHTAAMHGHLEAVKVLLKRCQYEPDYRDNCGVTALM DAIQCGHIDVARLLLDEHGACLSAEDSLGAQALHRAAVTGQDEAIRFLVSELGVDVDVRATSTHLTALHY AAKEGHTSTIQTLLSLGADINSKDEKNRSALHLACAGQHLACAKFLLQSGLKDSEDITGTLAQQLPRRAD VLQGSGHSAMT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001009941 |
Locus ID | 54522 |
UniProt ID | Q6P6B7 |
Cytogenetics | 10p15.1 |
Refseq Size | 1683 |
Refseq ORF | 1083 |
Summary | Required to prevent the misactivation of serine (Ser) with tRNA(Ala) by promoting the hydrolysis of Ser-mischarged tRNA(Ala), thereby playing a role in translational fidelity. Binds directly to the catalytic domain of AARS/AlaRS and captures Ser that is misactivated by AARS/AlaRS, preventing the charging of Ser adenylates to tRNA(Ala) and precluding Ser misincorporation in nascent peptides.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412786 | ANKRD16 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC423159 | ANKRD16 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC423160 | ANKRD16 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC423161 | ANKRD16 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY412786 | Transient overexpression lysate of ankyrin repeat domain 16 (ANKRD16), transcript variant 1 |
USD 436.00 |
|
LY423159 | Transient overexpression lysate of ankyrin repeat domain 16 (ANKRD16), transcript variant 2 |
USD 436.00 |
|
LY423160 | Transient overexpression lysate of ankyrin repeat domain 16 (ANKRD16), transcript variant 3 |
USD 436.00 |
|
LY423161 | Transient overexpression lysate of ankyrin repeat domain 16 (ANKRD16), transcript variant 4 |
USD 436.00 |
|
PH309157 | ANKRD16 MS Standard C13 and N15-labeled recombinant protein (NP_061919) |
USD 3,255.00 |
|
PH315131 | ANKRD16 MS Standard C13 and N15-labeled recombinant protein (NP_001009941) |
USD 3,255.00 |
|
PH322437 | ANKRD16 MS Standard C13 and N15-labeled recombinant protein (NP_001009942) |
USD 3,255.00 |
|
TP309157 | Recombinant protein of human ankyrin repeat domain 16 (ANKRD16), transcript variant 1, 20 µg |
USD 867.00 |
|
TP322437 | Purified recombinant protein of Homo sapiens ankyrin repeat domain 16 (ANKRD16), transcript variant 3, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review