SERPINB10 (NM_005024) Human Recombinant Protein
CAT#: TP313932
Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 10 (SERPINB10), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213932 protein sequence
Red=Cloning site Green=Tags(s) MDSLATSINQFALELSKKLAESAQGKNIFFSSWSISTSLTIVYLGAKGTTAAQMAQVLQFNRDQGVKCDP ESEKKRKMEFNLSNSEEIHSDFQTLISEILKPNDDYLLKTANAIYGEKTYAFHNKYLEDMKTYFGAEPQP VNFVEASDQIRKDINSWVERQTEGKIQNLLPDDSVDSTTRMILVNALYFKGIWEHQFLVQNTTEKPFRIN ETTSKPVQMMFMKKKLHIFHIEKPKAVGLQLYYKSRDLSLLILLPEDINGLEQLEKAITYEKLNEWTSAD MMELYEVQLHLPKFKLEDSYDLKSTLSSMGMSDAFSQSKADFSGMSSARNLFLSNVFHKAFVEINEQGTE AAAGSGSEINIRIRVPSIEFNANHPFLFFIRHNKTNTILFYGRLCSP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 45.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005015 |
Locus ID | 5273 |
UniProt ID | P48595, B2RC45 |
Cytogenetics | 18q22.1 |
Refseq Size | 1194 |
Refseq ORF | 1192 |
Synonyms | PI-10; PI10 |
Summary | This gene is a member of the serpin peptidase inhibitor, clade B family and is found in a cluster of other similar genes on chromosome 18. The protein encoded by this gene appears to help control the regulation of protease functions during hematopoiesis. Variations in this gene may increase the risk of prostate cancer. [provided by RefSeq, Dec 2015] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417586 | SERPINB10 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY417586 | Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 10 (SERPINB10) |
USD 436.00 |
|
PH313932 | SERPINB10 MS Standard C13 and N15-labeled recombinant protein (NP_005015) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review