SERPINB10 (NM_005024) Human Recombinant Protein

CAT#: TP313932

Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 10 (SERPINB10), 20 µg

Product Images

Coomassie blue staining of purified SERPINB10 protein (Cat# TP313932). The protein was produced from HEK293T cells transfected with SERPINB10 cDNA clone (Cat# RC213932) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC213932 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDSLATSINQFALELSKKLAESAQGKNIFFSSWSISTSLTIVYLGAKGTTAAQMAQVLQFNRDQGVKCDP
  ESEKKRKMEFNLSNSEEIHSDFQTLISEILKPNDDYLLKTANAIYGEKTYAFHNKYLEDMKTYFGAEPQP
  VNFVEASDQIRKDINSWVERQTEGKIQNLLPDDSVDSTTRMILVNALYFKGIWEHQFLVQNTTEKPFRIN
  ETTSKPVQMMFMKKKLHIFHIEKPKAVGLQLYYKSRDLSLLILLPEDINGLEQLEKAITYEKLNEWTSAD
  MMELYEVQLHLPKFKLEDSYDLKSTLSSMGMSDAFSQSKADFSGMSSARNLFLSNVFHKAFVEINEQGTE
  AAAGSGSEINIRIRVPSIEFNANHPFLFFIRHNKTNTILFYGRLCSP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 45.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005015
• Locus ID: 5273
• UniProt ID: P48595, B2RC45
• Cytogenetics: 18q22.1
• Refseq Size: 1194
• Refseq ORF: 1192
• Synonyms: PI-10; PI10
• Summary: This gene is a member of the serpin peptidase inhibitor, clade B family and is found in a cluster of other similar genes on chromosome 18. The protein encoded by this gene appears to help control the regulation of protease functions during hematopoiesis. Variations in this gene may increase the risk of prostate cancer. [provided by RefSeq, Dec 2015]
• Protein Families: Druggable Genome