Septin 8 (SEPT8) (NM_015146) Human Recombinant Protein
CAT#: TP313550
Purified recombinant protein of Homo sapiens septin 8 (SEPT8), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213550 representing NM_015146
Red=Cloning site Green=Tags(s) MAATDLERFSNAEPEPRSLSLGGHVGFDSLPDQLVSKSVTQGFSFNILCVGETGIGKSTLMNTLFNTTFE TEEASHHEACVRLRPQTYDLQESNVQLKLTIVDAVGFGDQINKDESYRPIVDYIDAQFENYLQEELKIRR SLFDYHDTRIHVCLYFITPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTISKSELHKFKIKIMGELVSN GVQIYQFPTDDEAVAEINAVMNAHLPFAVVGSTEEVKVGNKLVRARQYPWGVVQVENENHCDFVKLREML IRVNMEDLREQTHSRHYELYRRCKLEEMGFQDSDGDSQPFSLQETYEAKRKEFLSELQRKEEEMRQMFVN KVKETELELKEKERELHEKFEHLKRVHQEEKRKVEEKRRELEEETNAFNRRKAAVEALQSQALHATSQQP LRKDKDKKN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 49.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055961 |
Locus ID | 23176 |
UniProt ID | Q92599 |
Cytogenetics | 5q31.1 |
Refseq Size | 4344 |
Refseq ORF | 1287 |
Synonyms | SEP2; SEPT8 |
Summary | This gene is a member of the septin family of nucleotide binding proteins, originally described in yeast as cell division cycle regulatory proteins. Septins are highly conserved in yeast, Drosophila, and mouse, and appear to regulate cytoskeletal organization. Disruption of septin function disturbs cytokinesis and results in large multinucleate or polyploid cells. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414742 | 42255 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC420343 | 42255 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC420345 | 42255 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY414742 | Transient overexpression lysate of septin 8 (SEPT8), transcript variant 2 |
USD 665.00 |
|
LY420343 | Transient overexpression lysate of septin 8 (SEPT8), transcript variant 1 |
USD 665.00 |
|
LY420345 | Transient overexpression lysate of septin 8 (SEPT8), transcript variant 4 |
USD 436.00 |
|
PH313550 | SEPT8 MS Standard C13 and N15-labeled recombinant protein (NP_055961) |
USD 3,255.00 |
|
PH316253 | SEPT8 MS Standard C13 and N15-labeled recombinant protein (NP_001092283) |
USD 3,255.00 |
|
PH322095 | SEPT8 MS Standard C13 and N15-labeled recombinant protein (NP_001092281) |
USD 3,255.00 |
|
TP316253 | Recombinant protein of human septin 8 (SEPT8), transcript variant 4, 20 µg |
USD 867.00 |
|
TP322095 | Recombinant protein of human septin 8 (SEPT8), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review