SH3GL3 (NM_003027) Human Recombinant Protein

CAT#: TP313522

Recombinant protein of human SH3-domain GRB2-like 3 (SH3GL3), transcript variant 1, 20 µg

Product Images

Coomassie blue staining of purified SH3GL3 protein (Cat# TP313522). The protein was produced from HEK293T cells transfected with SH3GL3 cDNA clone (Cat# RC213522) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC213522 representing NM_003027
  Red=Cloning site Green=Tags(s)
  
  MSVAGLKKQFHKASQLFSEKISGAEGTKLDDEFLDMERKIDVTNKVVAEILSKTTEYLQPNPAYRAKLGM
  LNTVSKIRGQVKTTGYPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGESMKLMAEVKDSLDINVKQTFI
  DPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKIPDEEVRQAVEKFEESKELAERSMFNFLENDVE
  QVSQLAVFIEAALDYHRQSTEILQELQSKLQMRISAASSVPRREYKPRPVKRSSSELNGVSTTSVVKTTG
  SNIPMDQPCCRGLYDFEPENQGELGFKEGDIITLTNQIDENWYEGMIHGESGFFPINYVEVIVPLPQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 39.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003018
• Locus ID: 6457
• UniProt ID: Q99963
• Cytogenetics: 15q25.2
• Refseq Size: 2015
• Refseq ORF: 1041
• Synonyms: CNSA3; EEN-B2; HsT19371; SH3D2C; SH3P13
• Summary: Implicated in endocytosis. May recruit other proteins to membranes with high curvature (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Pathways: Endocytosis