SULT1C4 (NM_006588) Human Recombinant Protein
CAT#: TP313146
Recombinant protein of human sulfotransferase family, cytosolic, 1C, member 4 (SULT1C4), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213146 representing NM_006588
Red=Cloning site Green=Tags(s) MALHDMEDFTFDGTKRLSVNYVKGILQPTDTCDIWDKIWNFQAKPDDLLISTYPKAGTTWTQEIVELIQN EGDVEKSKRAPTHQRFPFLEMKIPSLGSGLEQAHAMPSPRILKTHLPFHLLPPSLLEKNCKIIYVARNPK DNMVSYYHFQRMNKALPAPGTWEEYFETFLAGKVCWGSWHEHVKGWWEAKDKHRILYLFYEDMKKNPKHE IQKLAEFIGKKLDDKVLDKIVHYTSFDVMKQNPMANYSSIPAEIMDHSISPFMRKGAVGDWKKHFTVAQN ERFDEDYKKKMTDTRLTFHFQF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006579 |
Locus ID | 27233 |
UniProt ID | O75897 |
Cytogenetics | 2q12.3 |
Refseq Size | 1664 |
Refseq ORF | 906 |
Synonyms | SULT1C; SULT1C2 |
Summary | Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that belongs to the SULT1 subfamily, responsible for transferring a sulfo moiety from PAPS to phenol-containing compounds. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416541 | SULT1C4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY416541 | Transient overexpression lysate of sulfotransferase family, cytosolic, 1C, member 4 (SULT1C4) |
USD 436.00 |
|
PH313146 | SULT1C4 MS Standard C13 and N15-labeled recombinant protein (NP_006579) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review