SULT1C4 (NM_006588) Human Mass Spec Standard

CAT#: PH313146

SULT1C4 MS Standard C13 and N15-labeled recombinant protein (NP_006579)

Product Images

Coomassie blue staining of purified SULT1C4 protein (Cat# TP313146). The protein was produced from HEK293T cells transfected with SULT1C4 cDNA clone (Cat# RC213146) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC213146
• Predicted MW: 35.3 kDa
• Protein Sequence:
  Sequence Link

  >RC213146 representing NM_006588
  Red=Cloning site Green=Tags(s)
  
  MALHDMEDFTFDGTKRLSVNYVKGILQPTDTCDIWDKIWNFQAKPDDLLISTYPKAGTTWTQEIVELIQN
  EGDVEKSKRAPTHQRFPFLEMKIPSLGSGLEQAHAMPSPRILKTHLPFHLLPPSLLEKNCKIIYVARNPK
  DNMVSYYHFQRMNKALPAPGTWEEYFETFLAGKVCWGSWHEHVKGWWEAKDKHRILYLFYEDMKKNPKHE
  IQKLAEFIGKKLDDKVLDKIVHYTSFDVMKQNPMANYSSIPAEIMDHSISPFMRKGAVGDWKKHFTVAQN
  ERFDEDYKKKMTDTRLTFHFQF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006579
• RefSeq Size: 1664
• RefSeq ORF: 906
• Synonyms: SULT1C; SULT1C2
• Locus ID: 27233
• UniProt ID: O75897
• Cytogenetics: 2q12.3
• Summary: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that belongs to the SULT1 subfamily, responsible for transferring a sulfo moiety from PAPS to phenol-containing compounds. [provided by RefSeq, Jul 2008]