KChIP2 (KCNIP2) (NM_014591) Human Recombinant Protein
CAT#: TP313131
Recombinant protein of human Kv channel interacting protein 2 (KCNIP2), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213131 representing NM_014591
Red=Cloning site Green=Tags(s) MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSEIGRVFRFLGDSSLP SALAAPASLRPHRPRLLDPDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNECPSGIVNE ENFKQIYSQFFPQGDSSTYATFLFNAFDTNHDGSVSFEDFVAGLSVILRGTVDDRLNWAFNLYDLNKDGC ITKEEMLDIMKSIYDMMGKYTYPALREEAPREHVESFFQKMDRNKDGVVTIEEFIESCQKDENIMRSMQL FDNVI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055406 |
Locus ID | 30819 |
UniProt ID | Q9NS61, B3KSZ5 |
Cytogenetics | 10q24.32 |
Refseq Size | 2608 |
Refseq ORF | 855 |
Synonyms | KCHIP2 |
Summary | This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Ion Channels: Other |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406637 | KCNIP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC406638 | KCNIP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC406642 | KCNIP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC415190 | KCNIP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY406637 | Transient overexpression lysate of Kv channel interacting protein 2 (KCNIP2), transcript variant 2 |
USD 436.00 |
|
LY406638 | Transient overexpression lysate of Kv channel interacting protein 2 (KCNIP2), transcript variant 3 |
USD 436.00 |
|
LY406642 | Transient overexpression lysate of Kv channel interacting protein 2 (KCNIP2), transcript variant 7 |
USD 436.00 |
|
LY415190 | Transient overexpression lysate of Kv channel interacting protein 2 (KCNIP2), transcript variant 1 |
USD 436.00 |
|
PH303823 | KCNIP2 MS Standard C13 and N15-labeled recombinant protein (NP_775284) |
USD 3,255.00 |
|
PH313131 | KCNIP2 MS Standard C13 and N15-labeled recombinant protein (NP_055406) |
USD 3,255.00 |
|
PH319876 | KCNIP2 MS Standard C13 and N15-labeled recombinant protein (NP_775283) |
USD 3,255.00 |
|
TP303823 | Recombinant protein of human Kv channel interacting protein 2 (KCNIP2), transcript variant 3, 20 µg |
USD 867.00 |
|
TP319876 | Recombinant protein of human Kv channel interacting protein 2 (KCNIP2), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review