KChIP2 (KCNIP2) (NM_014591) Human Recombinant Protein

CAT#: TP313131

Recombinant protein of human Kv channel interacting protein 2 (KCNIP2), transcript variant 1, 20 µg

Product Images

Coomassie blue staining of purified KCNIP2 protein (Cat# TP313131). The protein was produced from HEK293T cells transfected with KCNIP2 cDNA clone (Cat# RC213131) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC213131 representing NM_014591
  Red=Cloning site Green=Tags(s)
  
  MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSEIGRVFRFLGDSSLP
  SALAAPASLRPHRPRLLDPDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNECPSGIVNE
  ENFKQIYSQFFPQGDSSTYATFLFNAFDTNHDGSVSFEDFVAGLSVILRGTVDDRLNWAFNLYDLNKDGC
  ITKEEMLDIMKSIYDMMGKYTYPALREEAPREHVESFFQKMDRNKDGVVTIEEFIESCQKDENIMRSMQL
  FDNVI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 32.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_055406
• Locus ID: 30819
• UniProt ID: Q9NS61, B3KSZ5
• Cytogenetics: 10q24.32
• Refseq Size: 2608
• Refseq ORF: 855
• Synonyms: KCHIP2
• Summary: This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Ion Channels: Other