KLF14 (NM_138693) Human Recombinant Protein
CAT#: TP313087
Recombinant protein of human Kruppel-like factor 14 (KLF14), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213087 representing NM_138693
Red=Cloning site Green=Tags(s) MSAAVACLDYFAAECLVSMSAGAVVHRRPPDPEGAGGAAGSEVGAAHPESALPGPGPSGPASVPQLPQVP APSPGAGGAAPHLLAASVWADLRGSSGEGSWENSGEAPRASSGFSDPIPCSVQTPCSELAPASGAAAVCA PESSSDAPAVPSAPAAPGAPAASGGFSGGALGAGPAPAADQAPRRRSVTPAAKRHQCPFPGCTKAYYKSS HLKSHQRTHTGERPFSCDWLDCDKKFTRSDELARHYRTHTGEKRFSCPLCPKQFSRSDHLTKHARRHPTY HPDMIEYRGRRRTPRIDPPLTSEVESSASGSGPGPAPSFTTCL SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 32.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_619638 |
Locus ID | 136259 |
UniProt ID | Q8TD94 |
Cytogenetics | 7q32.2 |
Refseq Size | 1383 |
Refseq ORF | 969 |
Synonyms | BTEB5 |
Summary | This intronless gene encodes a member of the Kruppel-like family of transcription factors. The encoded protein functions as a transcriptional co-repressor, and is induced by transforming growth factor-beta (TGF-beta) to repress TGF-beta receptor II gene expression. This gene exhibits imprinted expression from the maternal allele in embryonic and extra-embryonic tissues. [provided by RefSeq, Jul 2013] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408547 | KLF14 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY408547 | Transient overexpression lysate of Kruppel-like factor 14 (KLF14) |
USD 436.00 |
|
PH313087 | KLF14 MS Standard C13 and N15-labeled recombinant protein (NP_619638) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review