C1QL2 (NM_182528) Human Recombinant Protein

CAT#: TP313000L

Recombinant protein of human complement component 1, q subcomponent-like 2 (C1QL2), 1 mg

Size: 20 ug 100 ug 1 mg


USD 9,200.00

6 Weeks*

Size
    • 1 mg

Product Images

Frequently bought together (2)
Rabbit polyclonal anti-C1QL2 antibody
    • 100 ul

USD 380.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 471.00

Other products for "C1QL2"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC213000 representing NM_182528
Red=Cloning site Green=Tags(s)

MALGLLIAVPLLLQAAPRGAAHYEMMGTCRMICDPYTAAPGGEPPGAKAQPPGPSTAALEVMQDLSANPP
PPFIQGPKGDPGRPGKPGPRGPPGEPGPPGPRGPPGEKGDSGRPGLPGLQLTAGTASGVGVVGGGAGVGG
DSEGEVTSALSATFSGPKIAFYVGLKSPHEGYEVLKFDDVVTNLGNHYDPTTGKFSCQVRGIYFFTYHIL
MRGGDGTSMWADLCKNGQVRASAIAQDADQNYDYASNSVVLHLDSGDEVYVKLDGGKAHGGNNNKYSTFS
GFLLYPD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 29.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_872334
Locus ID 165257
UniProt ID Q7Z5L3, A0A3B0IND4
Cytogenetics 2q14.2
Refseq Size 2066
Refseq ORF 861
Synonyms C1QTNF10; CTRP10
Summary May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses (By similarity).[UniProtKB/Swiss-Prot Function]
Protein Families Secreted Protein

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.