C2orf60 (TYW5) (NM_001039693) Human Recombinant Protein

CAT#: TP312399L

Recombinant protein of human chromosome 2 open reading frame 60 (C2orf60), transcript variant 1, 1 mg

Product Images

Coomassie blue staining of purified TYW5 protein (Cat# TP312399). The protein was produced from HEK293T cells transfected with TYW5 cDNA clone (Cat# RC212399) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC212399 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGQHLPVPRLEGVSREQFMQHLYPQRKPLVLEGIDLGPCTSKWTVDYLSQVGGKKEVKIHVAAVAQMDF
  ISKNFVYRTLPFDQLVQRAAEEKHKEFFVSEDEKYYLRSLGEDPRKDVADIRKQFPLLKGDIKFPEFFKE
  EQFFSSVFRISSPGLQLWTHYDVMDNLLIQVTGKKRVVLFSPRDAQYLYLKGTKSEVLNIDNPDLAKYPL
  FSKARRYECSLEAGDVLFIPALWFHNVISEEFGVGVNIFWKHLPSECYDKTDTYGNKDPTAASRAAQILD
  RALKTLAELPEEYRDFYARRMVLHIQDKAYSKNSE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 36.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001034782
• Locus ID: 129450
• UniProt ID: A2RUC4
• Cytogenetics: 2q33.1
• Refseq Size: 5384
• Refseq ORF: 945
• Synonyms: C2orf60; hTYW5
• Summary: tRNA hydroxylase that acts as a component of the wybutosine biosynthesis pathway. Wybutosine is a hyper modified guanosine with a tricyclic base found at the 3'-position adjacent to the anticodon of eukaryotic phenylalanine tRNA. Catalyzes the hydroxylation of 7-(a-amino-a-carboxypropyl)wyosine (yW-72) into undermodified hydroxywybutosine (OHyW*). OHyW* being further transformed into hydroxywybutosine (OHyW) by LCMT2/TYW4. OHyW is a derivative of wybutosine found in higher eukaryotes.[UniProtKB/Swiss-Prot Function]