C2orf60 (TYW5) (NM_001039693) Human Recombinant Protein
CAT#: TP312399
Recombinant protein of human chromosome 2 open reading frame 60 (C2orf60), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212399 protein sequence
Red=Cloning site Green=Tags(s) MAGQHLPVPRLEGVSREQFMQHLYPQRKPLVLEGIDLGPCTSKWTVDYLSQVGGKKEVKIHVAAVAQMDF ISKNFVYRTLPFDQLVQRAAEEKHKEFFVSEDEKYYLRSLGEDPRKDVADIRKQFPLLKGDIKFPEFFKE EQFFSSVFRISSPGLQLWTHYDVMDNLLIQVTGKKRVVLFSPRDAQYLYLKGTKSEVLNIDNPDLAKYPL FSKARRYECSLEAGDVLFIPALWFHNVISEEFGVGVNIFWKHLPSECYDKTDTYGNKDPTAASRAAQILD RALKTLAELPEEYRDFYARRMVLHIQDKAYSKNSE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 36.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001034782 |
Locus ID | 129450 |
UniProt ID | A2RUC4 |
Cytogenetics | 2q33.1 |
Refseq Size | 5384 |
Refseq ORF | 945 |
Synonyms | C2orf60; hTYW5 |
Summary | tRNA hydroxylase that acts as a component of the wybutosine biosynthesis pathway. Wybutosine is a hyper modified guanosine with a tricyclic base found at the 3'-position adjacent to the anticodon of eukaryotic phenylalanine tRNA. Catalyzes the hydroxylation of 7-(a-amino-a-carboxypropyl)wyosine (yW-72) into undermodified hydroxywybutosine (OHyW*). OHyW* being further transformed into hydroxywybutosine (OHyW) by LCMT2/TYW4. OHyW is a derivative of wybutosine found in higher eukaryotes.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421890 | TYW5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY421890 | Transient overexpression lysate of chromosome 2 open reading frame 60 (C2orf60), transcript variant 1 |
USD 436.00 |
|
PH312399 | C2orf60 MS Standard C13 and N15-labeled recombinant protein (NP_001034782) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review