IL20 (NM_018724) Human Recombinant Protein

CAT#: TP312397M

Recombinant protein of human interleukin 20 (IL20), 100 µg

Product Images

Coomassie blue staining of purified IL20 protein (Cat# TP312397). The protein was produced from HEK293T cells transfected with IL20 cDNA clone (Cat# RC212397) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC212397 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKASSLAFSLLSAAFYLLWTPSTGLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTES
  LQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMK
  KYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 19.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_061194
• Locus ID: 50604
• UniProt ID: Q9NYY1
• Cytogenetics: 1q32.1
• Refseq Size: 1252
• Refseq ORF: 528
• Synonyms: IL-20; IL10D; ZCYTO10
• Summary: The protein encoded by this gene is a cytokine structurally related to interleukin 10 (IL10). This cytokine has been shown to transduce its signal through signal transducer and activator of transcription 3 (STAT3) in keratinocytes. A specific receptor for this cytokine is found to be expressed in skin and upregulated dramatically in psoriatic skin, suggesting a role for this protein in epidermal function and psoriasis. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway