DEFB125 (NM_153325) Human Recombinant Protein

CAT#: TP312030L

Recombinant protein of human defensin, beta 125 (DEFB125), 1 mg

Product Images

Coomassie blue staining of purified DEFB125 protein (Cat# TP312030). The protein was produced from HEK293T cells transfected with DEFB125 cDNA clone (Cat# RC212030) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC212030 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNILMLTFIICGLLTRVTKGSFEPQKCWKNNVGHCRRRCLDTERYILLCRNKLSCCISIISHEYTRRPAF
  PVIHLEDITLDYSDVDSFTGSPVSMLNDLITFDTTKFGETMTPETNTPETTMPPSEATTPETTMPPSETA
  TSETMPPPSQTALTHN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 15.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_697020
• Locus ID: 245938
• UniProt ID: Q8N687, B2R4E8
• Cytogenetics: 20p13
• Refseq Size: 709
• Refseq ORF: 468
• Synonyms: DEFB-25
• Summary: Defensins are cysteine-rich cationic polypeptides that are important in the host immunologic response to invading microorganisms. The antimicrobial protein encoded by this gene is secreted and is a member of the beta defensin protein family. Beta defensin genes are found in several clusters throughout the genome, with this gene mapping to a cluster at 20p13. [provided by RefSeq, Nov 2014]
• Protein Families: Secreted Protein