HES1 (NM_005524) Human Recombinant Protein
CAT#: TP311709
Recombinant protein of human hairy and enhancer of split 1, (Drosophila) (HES1), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211709 representing NM_005524
Red=Cloning site Green=Tags(s) MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSS RHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLL GHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAPFAPPPPLVPIPGGAAPPPGGAPCKLGSQAG EAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 29.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005515 |
Locus ID | 3280 |
UniProt ID | Q14469 |
Cytogenetics | 3q29 |
Refseq Size | 1471 |
Refseq ORF | 840 |
Synonyms | bHLHb39; HES-1; HHL; HRY |
Summary | This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box. [provided by RefSeq, Jul 2008] |
Protein Families | Adult stem cells, Cancer stem cells, Druggable Genome, ES Cell Differentiation/IPS, Stem cell relevant signaling - DSL/Notch pathway, Transcription Factors |
Protein Pathways | Maturity onset diabetes of the young, Notch signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417251 | HES1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY417251 | Transient overexpression lysate of hairy and enhancer of split 1, (Drosophila) (HES1) |
USD 436.00 |
|
PH311709 | HES1 MS Standard C13 and N15-labeled recombinant protein (NP_005515) |
USD 3,255.00 |
|
TP760671 | Purified recombinant protein of Human hairy and enhancer of split 1, (Drosophila) (HES1), with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review