IL36RN (NM_012275) Human Recombinant Protein

CAT#: TP311691M

Recombinant protein of human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1, 100 µg

Product Images

Coomassie blue staining of purified IL36RN protein (Cat# TP311691). The protein was produced from HEK293T cells transfected with IL36RN cDNA clone (Cat# RC211691) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC211691 representing NM_012275
  Red=Cloning site Green=Tags(s)
  
  MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSC
  GVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENG
  GWNAPITDFYFQQCD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 16.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_036407
• Locus ID: 26525
• UniProt ID: Q9UBH0, A0A024R518
• Cytogenetics: 2q14.1
• Refseq Size: 2717
• Refseq ORF: 465
• Synonyms: FIL1; FIL1(DELTA); FIL1D; IL-36Ra; IL1F5; IL1HY1; IL1L1; IL1RP3; IL36RA; PSORP; PSORS14
• Summary: The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine was shown to specifically inhibit the activation of NF-kappaB induced by interleukin 1 family, member 6 (IL1F6). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Secreted Protein