PGRPS (PGLYRP1) (NM_005091) Human Recombinant Protein

CAT#: TP311040

Recombinant protein of human peptidoglycan recognition protein 1 (PGLYRP1), 20 µg

Product Images

Coomassie blue staining of purified PGLYRP1 protein (Cat# TP311040). The protein was produced from HEK293T cells transfected with PGLYRP1 cDNA clone (Cat# RC211040) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC211040 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSRRSMLLAWALPSLLRLGAAQETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTP
  ASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVP
  TPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 21.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005082
• Locus ID: 8993
• UniProt ID: O75594
• Cytogenetics: 19q13.32
• Refseq Size: 972
• Refseq ORF: 588
• Synonyms: PGLYRP; PGRP; PGRP-S; PGRPS; TAG7; TNFSF3L
• Summary: Pattern receptor that binds to murein peptidoglycans (PGN) of Gram-positive bacteria. Has bactericidal activity towards Gram-positive bacteria. May kill Gram-positive bacteria by interfering with peptidoglycan biosynthesis. Binds also to Gram-negative bacteria, and has bacteriostatic activity towards Gram-negative bacteria. Plays a role in innate immunity.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Secreted Protein