Macrophage Inflammatory Protein 3 (CCL23) (NM_145898) Human Recombinant Protein

CAT#: TP310897

Recombinant protein of human chemokine (C-C motif) ligand 23 (CCL23), transcript variant CKbeta8, 20 µg

Product Images

Coomassie blue staining of purified CCL23 protein (Cat# TP310897). The protein was produced from HEK293T cells transfected with CCL23 cDNA clone (Cat# RC210897) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210897 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKVSVAALSCLMLVTALGSQARVTKDAETEFMMSKLPLENPVLLDRFHATSADCCISYTPRSIPCSLLES
  YFETNSECSKPGVIFLTKKGRRFCANPSDKQVQVCMRMLKLDTRIKTRKN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 11.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_665905
• Locus ID: 6368
• UniProt ID: P55773
• Cytogenetics: 17q12
• Refseq Size: 604
• Refseq ORF: 360
• Synonyms: CK-BETA-8; Ckb-8; Ckb-8-1; CKb8; hmrp-2a; MIP-3; MIP3; MPIF-1; SCYA23
• Summary: This gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, displays chemotactic activity on resting T lymphocytes and monocytes, lower activity on neutrophils and no activity on activated T lymphocytes. The protein is also a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line. In addition, the product of this gene is a potent agonist of the chemokine (C-C motif) receptor 1. Alternative splicing results in multiple transcript variants that encode different isoforms. [provided by RefSeq, Jul 2013]
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Chemokine signaling pathway, Cytokine-cytokine receptor interaction