NDUFC1 (NM_002494) Human Recombinant Protein

CAT#: TP310771M

Recombinant protein of human NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 1, 6kDa (NDUFC1), 100 µg

Product Images

Coomassie blue staining of purified NDUFC1 protein (Cat# TP310771). The protein was produced from HEK293T cells transfected with NDUFC1 cDNA clone (Cat# RC210771) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210771 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPSALLRPLSRLLAPARLPSGPSVRSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIKQHNEDILEYK
  RRNGLE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 8.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002485
• Locus ID: 4717
• UniProt ID: O43677
• Cytogenetics: 4q31.1
• Refseq Size: 860
• Refseq ORF: 228
• Synonyms: KFYI
• Summary: The encoded protein is a subunit of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2010]
• Protein Pathways: Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease