Acyl coenzyme A Thioesterase 4 (ACOT4) (NM_152331) Human Recombinant Protein

CAT#: TP310550L

Recombinant protein of human acyl-CoA thioesterase 4 (ACOT4), 1 mg

Product Images

Coomassie blue staining of purified ACOT4 protein (Cat# TP310550). The protein was produced from HEK293T cells transfected with ACOT4 cDNA clone (Cat# RC210550) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210550 representing NM_152331
  Red=Cloning site Green=Tags(s)
  
  MSATLILEPPGRCCWNEPVRIAVRGLAPEQRVTLRASLRDEKGALFRAHARYCADARGELDLERAPALGG
  SFAGLEPMGLLWALEPEKPFWRFLKRDVQIPFVVELEVLDGHDPEPGRLLCQAQHERHFLPPGVRRQSVR
  AGRVRATLFLPPGPGPFPGIIDIFGIGGGLLEYRASLLAGHGFATLALAYYNFEDLPNNMDNISLEYFEE
  AVCYMLQHPQVKGPGIGLLGISLGADICLSMASFLKNVSATVSINGSGISGNTAINYKHSSIPPLGYDLR
  RIKVAFSGLVDIVDIRNALVGGYKNPSMIPIEKAQGPILLIVGQDDHNWRSELYAQTVSERLQAHGKEKP
  QIICYPGTGHYIEPPYFPLCPASLHRLLNKHVIWGGEPRAHSKAQEDAWKQILAFFCKHLGGTQKTAVPK
  L
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 46.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_689544
• Locus ID: 122970
• UniProt ID: Q8N9L9
• Cytogenetics: 14q24.3
• Refseq Size: 1703
• Refseq ORF: 1263
• Synonyms: PTE-Ib; PTE1B; PTE2B
• Summary: Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH (PubMed:16940157). ACOT4 is a peroxisomal succinyl-coenzyme A thioesterase can also hydrolyze glutaryl-CoA and long chain saturated acyl-CoAs (PubMed:16940157).[UniProtKB/Swiss-Prot Function]
• Protein Pathways: Biosynthesis of unsaturated fatty acids