RPA4 (NM_013347) Human Recombinant Protein

CAT#: TP310239M

Recombinant protein of human replication protein A4, 34kDa (RPA4), 100 µg

Product Images

Coomassie blue staining of purified RPA4 protein (Cat# TP310239). The protein was produced from HEK293T cells transfected with RPA4 cDNA clone (Cat# RC210239) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210239 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSKSGFGSYGSISAADGASGGSDQLCERDATPAIKTQRPKVRIQDVVPCNVNQLLSSTVFDPVFKVRGII
  VSQVSIVGVIRGAEKASNHICYKIDDMTAKPIEARQWFGREKVKQVTPLSVGVYVKVFGILKCPTGTKSL
  EVLKIHVLEDMNEFTVHILETVNAHMMLDKARRDTTVESVPVSPSEVNDAGDNDESHRNFIQDEVLRLIH
  ECPHQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSAD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 28.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_037479
• Locus ID: 29935
• UniProt ID: Q13156
• Cytogenetics: Xq21.33
• Refseq Size: 1560
• Refseq ORF: 783
• Synonyms: HSU24186
• Summary: This gene encodes a single-stranded DNA-binding protein that is the 30-kDa subunit of the replication protein A complex. Replication protein A is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation. The encoded protein localizes to DNA repair foci and may be involved in the cellular DNA damage response. This protein may also play a role in inhibiting viral replication.[provided by RefSeq, Apr 2010]
• Protein Families: Druggable Genome
• Protein Pathways: DNA replication, Homologous recombination, Mismatch repair, Nucleotide excision repair