MMP16 (NM_005941) Human Recombinant Protein

CAT#: TP310199

Recombinant protein of human matrix metallopeptidase 16 (membrane-inserted) (MMP16), transcript Variant 1, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20 μg

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210199 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MILLTFSTGRRLDFVHHSGVFFLQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQ
  SALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYALTGQKWQHKHITYSIKNVT
  PKVGDPETRKAIRRAFDVWQNVTPLTFEEVPYSELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAY
  FPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPN
  DDLQGIQKIYGPPDKIPPPTRPLPTVPPHRSIPPADPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTL
  AILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTTLQ
  PGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITVWKGIPESPQGA
  FVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDRVKEGHSPPDDVDIVIKLDNTAS
  TVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILYCKRSMQEWV
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 69.5 kDa
• Concentration: >0.05 ug/uL as determined by Bradford protein assay method.
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 100 mM Glycine, pH 3.5, 10% Glycerol
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005932
• Locus ID: 4325
• UniProt ID: P51512
• Cytogenetics: 8q21.3
• Refseq Size: 6347
• Refseq ORF: 1821
• Synonyms: C8orf57; MMP-X2; MT-MMP2; MT-MMP3; MT3-MMP
• Summary: Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The encoded protein activates MMP2 by cleavage. This gene was once referred to as MT-MMP2, but was renamed as MT-MMP3 or MMP16. [provided by RefSeq, Oct 2010]
• Protein Families: Druggable Genome, Protease, Secreted Protein, Transmembrane