CDC26 (NM_139286) Human Recombinant Protein

CAT#: TP309719M

Recombinant protein of human cell division cycle 26 homolog (S. cerevisiae) (CDC26), 100 µg

Product Images

Coomassie blue staining of purified CDC26 protein (Cat# TP309719). The protein was produced from HEK293T cells transfected with CDC26 cDNA clone (Cat# RC209719) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209719 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQ
  PKPNNRSSQFGSLEF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 9.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_644815
• Locus ID: 246184
• UniProt ID: Q8NHZ8, A0A024R832
• Cytogenetics: 9q32
• Refseq Size: 885
• Refseq ORF: 255
• Synonyms: ANAPC12; APC12; C9orf17
• Summary: The protein encoded by this gene is highly similar to Saccharomyces cerevisiae Cdc26, a component of cell cycle anaphase-promoting complex (APC). APC is composed of a group of highly conserved proteins and functions as a cell cycle-regulated ubiquitin-protein ligase. APC thus is responsible for the cell cycle regulated proteolysis of various proteins. [provided by RefSeq, Jul 2008]
• Protein Pathways: Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation, Ubiquitin mediated proteolysis