Inositol Hexakisphosphate Kinase 2 (IP6K2) (NM_016291) Human Recombinant Protein

CAT#: TP309533

Recombinant protein of human inositol hexakisphosphate kinase 2 (IP6K2), transcript variant 1, 20 µg

Product Images

Coomassie blue staining of purified IP6K2 protein (Cat# TP309533). The protein was produced from HEK293T cells transfected with IP6K2 cDNA clone (Cat# RC209533) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209533 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMRKFTPQYKGVV
  SVRFEEDEDRNLCLIAYPLKGDHGIVDIVDNSDCEPKSKLLRWTTNKKHHVLETEKTPKDWVRQHRKEEK
  MKSHKLEEEFEWLKKSEVLYYTVEKKWNISSQLKHYNPWSMKCHQQQLQRMKENAKHRNQYKFILLENLT
  SRYEVPCVLDLKMGTRQHGDDASEEKAANQIRKCQQSTSAVIGVRVCGMQVYQAGSGQLMFMNKYHGRKL
  SVQGFKEALFQFFHNGRYLRRELLGPVLKKLTELKAVLERQESYRFYSSSLLVIYDGKERPEVVLDSDAE
  DLEDLSEESADESAGAYAYKPIGASSVDVRMIDFAHTTCRLYGEDTVVHEGQDAGYIFGLQSLIDIVTEI
  SEESGE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 49 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057375
• Locus ID: 51447
• UniProt ID: Q9UHH9, B2RCP4
• Cytogenetics: 3p21.31
• Refseq Size: 1813
• Refseq ORF: 1278
• Synonyms: IHPK2; InsP6K2; PIUS
• Summary: This gene encodes a protein that belongs to the inositol phosphokinase (IPK) family. This protein is likely responsible for the conversion of inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). It may also convert 1,3,4,5,6-pentakisphosphate (InsP5) to PP-InsP4 and affect the growth suppressive and apoptotic activities of interferon-beta in some ovarian cancers. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome